Recombinant Full Length Human LSMEM2 Protein, GST-tagged
| Cat.No. : | LSMEM2-3839HF |
| Product Overview : | Human C3orf45 full-length ORF (BAC04652.1, 1 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 164 amino acids |
| Description : | LSMEM2 (Leucine Rich Single-Pass Membrane Protein 2) is a Protein Coding gene. |
| Molecular Mass : | 44.3 kDa |
| AA Sequence : | MPSLAPDCPLLAMPEETQEDSVAPMMPSQRSRGPLAPNHVHEVCLHQVESISDLHSGAGTLRPYLTEEARPWDELLGVLPPSLCAQAGCSPVYRRGGFLLLLALLVLTCLVLALLAVYLSVLQSESLRILAHTLRTQEETLLKLRLASLSQLRRLNSSEAQAPS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LSMEM2 leucine rich single-pass membrane protein 2 [ Homo sapiens (human) ] |
| Official Symbol | LSMEM2 |
| Synonyms | LSMEM2; leucine rich single-pass membrane protein 2; C3orf45; leucine-rich single-pass membrane protein 2 |
| Gene ID | 132228 |
| mRNA Refseq | NM_001304385 |
| Protein Refseq | NP_001291314 |
| UniProt ID | Q8N112 |
| ◆ Recombinant Proteins | ||
| RFL10008HF | Recombinant Full Length Human Uncharacterized Protein C3Orf45(C3Orf45) Protein, His-Tagged | +Inquiry |
| LSMEM2-3839HF | Recombinant Full Length Human LSMEM2 Protein, GST-tagged | +Inquiry |
| LSMEM2-5216H | Recombinant Human LSMEM2 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LSMEM2 Products
Required fields are marked with *
My Review for All LSMEM2 Products
Required fields are marked with *
