Recombinant Full Length Human LSMEM2 Protein, GST-tagged

• Cat.No.: LSMEM2-3839HF
• Product Overview: Human C3orf45 full-length ORF (BAC04652.1, 1 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 164 amino acids
• Description: LSMEM2 (Leucine Rich Single-Pass Membrane Protein 2) is a Protein Coding gene.
• Molecular Mass: 44.3 kDa
• AA Sequence: MPSLAPDCPLLAMPEETQEDSVAPMMPSQRSRGPLAPNHVHEVCLHQVESISDLHSGAGTLRPYLTEEARPWDELLGVLPPSLCAQAGCSPVYRRGGFLLLLALLVLTCLVLALLAVYLSVLQSESLRILAHTLRTQEETLLKLRLASLSQLRRLNSSEAQAPS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LSMEM2 leucine rich single-pass membrane protein 2 [ Homo sapiens (human) ]
• Official Symbol: LSMEM2
• Synonyms: LSMEM2; leucine rich single-pass membrane protein 2; C3orf45; leucine-rich single-pass membrane protein 2
• Gene ID: 132228
• mRNA Refseq: NM_001304385
• Protein Refseq: NP_001291314
• UniProt ID: Q8N112