Recombinant Full Length Human LTA Protein, GST-tagged
| Cat.No. : | LTA-6059HF |
| Product Overview : | Human LTA full-length ORF ( AAH34729, 1 a.a. - 205 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 205 amino acids |
| Description : | The encoded protein, a member of the tumor necrosis factor family, is a cytokine produced by lymphocytes. The protein is highly inducible, secreted, and forms heterotrimers with lymphotoxin-beta which anchor lymphotoxin-alpha to the cell surface. This protein also mediates a large variety of inflammatory, immunostimulatory, and antiviral responses, is involved in the formation of secondary lymphoid organs during development and plays a role in apoptosis. Genetic variations in this gene are associated with susceptibility to leprosy type 4 and psoriatic arthritis |
| Molecular Mass : | 48.29 kDa |
| AA Sequence : | MTPPERLFLPRVRGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LTA lymphotoxin alpha (TNF superfamily, member 1) [ Homo sapiens ] |
| Official Symbol | LTA |
| Synonyms | LTA; lymphotoxin alpha (TNF superfamily, member 1); TNFB; lymphotoxin-alpha; LT; TNFSF1; LT-alpha; TNF-beta; tumor necrosis factor beta; tumor necrosis factor ligand superfamily member 1; |
| Gene ID | 4049 |
| mRNA Refseq | NM_000595 |
| Protein Refseq | NP_000586 |
| MIM | 153440 |
| UniProt ID | P01374 |
| ◆ Recombinant Proteins | ||
| Lta-070H | Recombinant Human Lta Protein | +Inquiry |
| Lta-1346M | Recombinant Mouse Lta Protein, MYC/DDK-tagged | +Inquiry |
| LTA-572R | Recombinant Rabbit LTA protein, His & T7-tagged | +Inquiry |
| LTA-2131HFL | Recombinant Full Length Human LTA Protein, C-Flag-tagged | +Inquiry |
| LTA-9342M | Recombinant Mouse LTA Protein | +Inquiry |
| ◆ Native Proteins | ||
| LTA-18S | Native S. aureus LTA Protein | +Inquiry |
| LTA-15B | Native Bacillus subtilis LTA Protein | +Inquiry |
| LTA-14S | Native S. aureus LTA Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LTA-9167HCL | Recombinant Human LTA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LTA Products
Required fields are marked with *
My Review for All LTA Products
Required fields are marked with *
