Recombinant Full Length Human LTB4R Protein
| Cat.No. : | LTB4R-6133HF |
| Product Overview : | Human LTB4R full-length ORF (ABW03628.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 878 amino acids |
| Description : | LTB4R (Leukotriene B4 Receptor) is a Protein Coding gene. Among its related pathways are Immune response CCR3 signaling in eosinophils and RET signaling. GO annotations related to this gene include G-protein coupled receptor activity and leukotriene receptor activity. An important paralog of this gene is LTB4R2. |
| Form : | Liquid |
| Molecular Mass : | 38.72 kDa |
| AA Sequence : | MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPFKLNELN |
| Applications : | Antibody Production Functional Study Compound Screening |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | LTB4R leukotriene B4 receptor [ Homo sapiens ] |
| Official Symbol | LTB4R |
| Synonyms | LTB4R; leukotriene B4 receptor; CMKRL1, GPR16, P2RY7; leukotriene B4 receptor 1; BLTR; LTB4R1; P2Y7; LTB4-R1; LTB4-R 1; P2Y purinoceptor 7; chemokine receptor-like 1; G protein-coupled receptor 16; G-protein coupled receptor 16; chemoattractant receptor-like 1; purinergic receptor P2Y, G-protein coupled, 7; BLT1; GPR16; LTBR1; P2RY7; CMKRL1; |
| Gene ID | 1241 |
| mRNA Refseq | NM_001143919 |
| Protein Refseq | NP_001137391 |
| MIM | 601531 |
| UniProt ID | Q15722 |
| ◆ Recombinant Proteins | ||
| LTB4R-26799TH | Recombinant Human LTB4R | +Inquiry |
| LTB4R-3498R | Recombinant Rat LTB4R Protein | +Inquiry |
| LTB4R-27118TH | Recombinant Human LTB4R | +Inquiry |
| LTB4R-27119TH | Recombinant Human LTB4R | +Inquiry |
| RFL11926MF | Recombinant Full Length Mouse Leukotriene B4 Receptor 1(Ltb4R) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LTB4R Products
Required fields are marked with *
My Review for All LTB4R Products
Required fields are marked with *
