Recombinant Full Length Human LTB4R Protein
Cat.No. : | LTB4R-6133HF |
Product Overview : | Human LTB4R full-length ORF (ABW03628.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 878 amino acids |
Description : | LTB4R (Leukotriene B4 Receptor) is a Protein Coding gene. Among its related pathways are Immune response CCR3 signaling in eosinophils and RET signaling. GO annotations related to this gene include G-protein coupled receptor activity and leukotriene receptor activity. An important paralog of this gene is LTB4R2. |
Form : | Liquid |
Molecular Mass : | 38.72 kDa |
AA Sequence : | MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNLALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVARPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAFHLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVVNLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGFVAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPFKLNELN |
Applications : | Antibody Production Functional Study Compound Screening |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Gene Name | LTB4R leukotriene B4 receptor [ Homo sapiens ] |
Official Symbol | LTB4R |
Synonyms | LTB4R; leukotriene B4 receptor; CMKRL1, GPR16, P2RY7; leukotriene B4 receptor 1; BLTR; LTB4R1; P2Y7; LTB4-R1; LTB4-R 1; P2Y purinoceptor 7; chemokine receptor-like 1; G protein-coupled receptor 16; G-protein coupled receptor 16; chemoattractant receptor-like 1; purinergic receptor P2Y, G-protein coupled, 7; BLT1; GPR16; LTBR1; P2RY7; CMKRL1; |
Gene ID | 1241 |
mRNA Refseq | NM_001143919 |
Protein Refseq | NP_001137391 |
MIM | 601531 |
UniProt ID | Q15722 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LTB4R Products
Required fields are marked with *
My Review for All LTB4R Products
Required fields are marked with *