Recombinant Full Length Human LURAP1 Protein, GST-tagged

Cat.No. : LURAP1-6218HF
Product Overview : Human LURAP1 full-length ORF ( ADZ15857.1, 1 a.a. - 239 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 239 amino acids
Description : LURAP1 (Leucine Rich Adaptor Protein 1) is a Protein Coding gene. An important paralog of this gene is LURAP1L.
Molecular Mass : 26.3 kDa
AA Sequence : MEGTVESQTPDLRDVEGKVGRKTPEGLLRGLRGECELGTSGALLLPGASSTGHDLGDKIMALKMELAYLRAIDVKILQQLVTLNEGIEAVRWLLEERGTLTSHCSSLTSSQYSLTGGSPGRSRRGSWDSLPDTSTTDRLDSVSIGSFLDTVAPSELDEQGPPGAPRSEMDWAKVIAGGERARTEVDVAATRLGSLRAVWKPPGERLQGGPPESPEDESAKLGFEAHWFWEQCQDDVTFL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LURAP1 leucine rich adaptor protein 1 [ Homo sapiens ]
Official Symbol LURAP1
Synonyms LRP35A; LRAP35a; C1orf190; LURAP1; leucine rich adaptor protein 1
Gene ID 541468
mRNA Refseq NM_001013615
Protein Refseq NP_001013633
MIM 616129
UniProt ID Q96LR2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LURAP1 Products

Required fields are marked with *

My Review for All LURAP1 Products

Required fields are marked with *

0
cart-icon