Recombinant Full Length Human LURAP1 Protein, GST-tagged
| Cat.No. : | LURAP1-6218HF |
| Product Overview : | Human LURAP1 full-length ORF ( ADZ15857.1, 1 a.a. - 239 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 239 amino acids |
| Description : | LURAP1 (Leucine Rich Adaptor Protein 1) is a Protein Coding gene. An important paralog of this gene is LURAP1L. |
| Molecular Mass : | 26.3 kDa |
| AA Sequence : | MEGTVESQTPDLRDVEGKVGRKTPEGLLRGLRGECELGTSGALLLPGASSTGHDLGDKIMALKMELAYLRAIDVKILQQLVTLNEGIEAVRWLLEERGTLTSHCSSLTSSQYSLTGGSPGRSRRGSWDSLPDTSTTDRLDSVSIGSFLDTVAPSELDEQGPPGAPRSEMDWAKVIAGGERARTEVDVAATRLGSLRAVWKPPGERLQGGPPESPEDESAKLGFEAHWFWEQCQDDVTFL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LURAP1 leucine rich adaptor protein 1 [ Homo sapiens ] |
| Official Symbol | LURAP1 |
| Synonyms | LRP35A; LRAP35a; C1orf190; LURAP1; leucine rich adaptor protein 1 |
| Gene ID | 541468 |
| mRNA Refseq | NM_001013615 |
| Protein Refseq | NP_001013633 |
| MIM | 616129 |
| UniProt ID | Q96LR2 |
| ◆ Recombinant Proteins | ||
| LURAP1-3161R | Recombinant Rat LURAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LURAP1-2594R | Recombinant Rhesus monkey LURAP1 Protein, His-tagged | +Inquiry |
| LURAP1-2414R | Recombinant Rhesus Macaque LURAP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LURAP1-6218HF | Recombinant Full Length Human LURAP1 Protein, GST-tagged | +Inquiry |
| LURAP1-3505R | Recombinant Rat LURAP1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LURAP1-8168HCL | Recombinant Human C1orf190 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LURAP1 Products
Required fields are marked with *
My Review for All LURAP1 Products
Required fields are marked with *
