Recombinant Full Length Human LY6H Protein, GST-tagged

Cat.No. : LY6H-6229HF
Product Overview : Human LY6H full-length ORF ( AAH28894, 26 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 26-140 amino acids
Description : LY6H (Lymphocyte Antigen 6 Family Member H) is a Protein Coding gene. Among its related pathways are Post-translational modification- synthesis of GPI-anchored proteins and Metabolism of proteins.
Molecular Mass : 38.39 kDa
AA Sequence : LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGAGHSPWALAGGLLLSLGPALLWAGP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LY6H lymphocyte antigen 6 complex, locus H [ Homo sapiens ]
Official Symbol LY6H
Synonyms LY6H; lymphocyte antigen 6 complex, locus H; lymphocyte antigen 6H; NMLY6; ly-6H;
Gene ID 4062
mRNA Refseq NM_001130478
Protein Refseq NP_001123950
MIM 603625
UniProt ID O94772

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LY6H Products

Required fields are marked with *

My Review for All LY6H Products

Required fields are marked with *

0
cart-icon
0
compare icon