Recombinant Full Length Human LY6H Protein, GST-tagged
| Cat.No. : | LY6H-6229HF |
| Product Overview : | Human LY6H full-length ORF ( AAH28894, 26 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 26-140 amino acids |
| Description : | LY6H (Lymphocyte Antigen 6 Family Member H) is a Protein Coding gene. Among its related pathways are Post-translational modification- synthesis of GPI-anchored proteins and Metabolism of proteins. |
| Molecular Mass : | 38.39 kDa |
| AA Sequence : | LWCQDCTLTTNSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASSCDFVKRHFFSDYLMGFINSGILKVDVDCCEKDLCNGAAGAGHSPWALAGGLLLSLGPALLWAGP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LY6H lymphocyte antigen 6 complex, locus H [ Homo sapiens ] |
| Official Symbol | LY6H |
| Synonyms | LY6H; lymphocyte antigen 6 complex, locus H; lymphocyte antigen 6H; NMLY6; ly-6H; |
| Gene ID | 4062 |
| mRNA Refseq | NM_001130478 |
| Protein Refseq | NP_001123950 |
| MIM | 603625 |
| UniProt ID | O94772 |
| ◆ Recombinant Proteins | ||
| LY6H-2419R | Recombinant Rhesus Macaque LY6H Protein, His (Fc)-Avi-tagged | +Inquiry |
| LY6H-667C | Recombinant Cynomolgus LY6H Protein, His-tagged | +Inquiry |
| LY6H-6229HF | Recombinant Full Length Human LY6H Protein, GST-tagged | +Inquiry |
| Ly6h-3871M | Recombinant Mouse Ly6h Protein, Myc/DDK-tagged | +Inquiry |
| LY6H-413C | Recombinant Cynomolgus Monkey LY6H Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LY6H-4598HCL | Recombinant Human LY6H 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LY6H Products
Required fields are marked with *
My Review for All LY6H Products
Required fields are marked with *



