Recombinant Full Length Human LY6K Protein, C-Flag-tagged
| Cat.No. : | LY6K-230HFL |
| Product Overview : | Recombinant Full Length Human LY6K Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Required for sperm migration into the oviduct and male fertility by controlling binding of sperm to zona pellucida (By similarity). May play a role in cell growth. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 18.5 kDa |
| AA Sequence : | MRLQRPRQAPAGGRRAPRGGRGSPYRPDPGRGARRLRRFQKGGEGAPRADPPWAPLGTMALLALLLVVAL PRVWTDANLTARQRDPEDSQRTDEGDNRVWCHVCERENTFECQNPRRCKWTEPYCVIAAVKIFPRFFMVA KQCSAGCAAMERPKPEEKRFLLEEPMPFFYLKCCKIRYCNLEGPPINSSVFKEYAGSMGESCGGLWLAIL LLLASIAAGLSLSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Transmembrane |
| Full Length : | Full L. |
| Gene Name | LY6K lymphocyte antigen 6 family member K [ Homo sapiens (human) ] |
| Official Symbol | LY6K |
| Synonyms | CT97; ly-6K; URLC10; HSJ001348 |
| Gene ID | 54742 |
| mRNA Refseq | NM_017527.4 |
| Protein Refseq | NP_059997.3 |
| MIM | 615093 |
| UniProt ID | Q17RY6 |
| ◆ Recombinant Proteins | ||
| Ly6k-3872M | Recombinant Mouse Ly6k Protein, Myc/DDK-tagged | +Inquiry |
| LY6K-1330H | Recombinant Human LY6K Protein, His (Fc)-Avi-tagged | +Inquiry |
| LY6K-5257M | Recombinant Mouse LY6K Protein, His (Fc)-Avi-tagged | +Inquiry |
| LY6K-45H | Recombinant Human LY6K protein, GST-tagged | +Inquiry |
| LY6K-6765H | Recombinant Human LY6K protein, His&Myc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LY6K-4597HCL | Recombinant Human LY6K 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LY6K Products
Required fields are marked with *
My Review for All LY6K Products
Required fields are marked with *
