Recombinant Full Length Human LYPD5 Protein, GST-tagged
| Cat.No. : | LYPD5-6240HF |
| Product Overview : | Human LYPD5 full-length ORF ( AAH57816, 1 a.a. - 249 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 249 amino acids |
| Description : | LYPD5 (LY6/PLAUR Domain Containing 5) is a Protein Coding gene. Among its related pathways are Post-translational modification- synthesis of GPI-anchored proteins and Metabolism of proteins. An important paralog of this gene is LYPD3. |
| Molecular Mass : | 53.13 kDa |
| AA Sequence : | MGVPRVILLCLFGAALCLTGSQALQCYSFEHTYLGPFDLRAMKLPSISCPHECFEAILSLDTGYRAPVTLVRKGCWTGPPAGQTQSNADALPPDYSVVRGCTTDKCNAHLMTHDALPNLSQAPDPPTLSGAECYACIGVHQDDCAIGRSRRVQCHQDQTACFQGNGRMTVGNFSVPVYIRTCHRPSCTTEGSTSPWTAIDLQGSCCEGYLCNRKSMTQPFTSASATTPPRALQVLALLLPVLLLVGLSA |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LYPD5 LY6/PLAUR domain containing 5 [ Homo sapiens ] |
| Official Symbol | LYPD5 |
| Synonyms | LYPD5; LY6/PLAUR domain containing 5; ly6/PLAUR domain-containing protein 5; FLJ30469; metastasis-associated protein; PRO4356; |
| Gene ID | 284348 |
| mRNA Refseq | NM_001031749 |
| Protein Refseq | NP_001026919 |
| MIM | 619618 |
| UniProt ID | Q6UWN5 |
| ◆ Recombinant Proteins | ||
| LYPD5-4552H | Recombinant Human LYPD5 Protein, GST-tagged | +Inquiry |
| LYPD5-6240HF | Recombinant Full Length Human LYPD5 Protein, GST-tagged | +Inquiry |
| LYPD5-9392M | Recombinant Mouse LYPD5 Protein | +Inquiry |
| LYPD5-5268M | Recombinant Mouse LYPD5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LYPD5-4590HCL | Recombinant Human LYPD5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYPD5 Products
Required fields are marked with *
My Review for All LYPD5 Products
Required fields are marked with *
