Recombinant Full Length Human LYRM1 Protein, GST-tagged
| Cat.No. : | LYRM1-6248HF |
| Product Overview : | Human LYRM1 full-length ORF ( ADZ15700.1, 1 a.a. - 122 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 122 amino acids |
| Description : | The protein encoded by this gene belongs to the mitochondrial leucine/tyrosine/arginine motif family of proteins. Proteins of this family are short polypeptides that contain a leucine/tyrosine/arginine motif near the N-terminus. This gene is widely expressed with high levels in omental adipose tissue of obese individuals. In adipose tissue, the protein is localized to the nucleus where it promotes preadipocyte proliferation and lowers the rate of apoptosis to regulate adipose tissue homeostasis. Overexpression of this gene in adipocytes causes abnormal mitochondrial morphology and mitochondrial dysfunction. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2014] |
| Molecular Mass : | 13.5 kDa |
| AA Sequence : | MTTATRQEVLGLYRSIFRLARKWQATSGQMEDTIKEKQYILNEARTLFRKNKNLTDTDLIKQCIDECTARIEIGLHYKIPYPRPIHLPPMGLTPLRGRGLRSQEKLRKLSKPVYLRSHDEVS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LYRM1 LYR motif containing 1 [ Homo sapiens ] |
| Official Symbol | LYRM1 |
| Synonyms | LYRM1; LYR motif containing 1; LYR motif-containing protein 1; A211C6.1; |
| Gene ID | 57149 |
| mRNA Refseq | NM_001128301 |
| Protein Refseq | NP_001121773 |
| MIM | 614709 |
| UniProt ID | O43325 |
| ◆ Recombinant Proteins | ||
| LYRM1-3963C | Recombinant Chicken LYRM1 | +Inquiry |
| LYRM1-4542H | Recombinant Human LYRM1 Protein, GST-tagged | +Inquiry |
| LYRM1-5271M | Recombinant Mouse LYRM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LYRM1-9399M | Recombinant Mouse LYRM1 Protein | +Inquiry |
| LYRM1-633Z | Recombinant Zebrafish LYRM1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LYRM1-4586HCL | Recombinant Human LYRM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYRM1 Products
Required fields are marked with *
My Review for All LYRM1 Products
Required fields are marked with *
