Recombinant Full Length Human LYZL2 Protein, GST-tagged
Cat.No. : | LYZL2-6042HF |
Product Overview : | Human LYZL2 full-length ORF ( NP_898881.2, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 194 amino acids |
Description : | Lysozymes (see LYZ; MIM 153450), especially C-type lysozymes, are well-recognized bacteriolytic factors widely distributed in the animal kingdom and play a mainly protective role in host defense. LYZL2 is a member of a family of lysozyme-like genes (Zhang et al., 2005 [PubMed 16014814]).[supplied by OMIM |
Molecular Mass : | 48 kDa |
AA Sequence : | MQDAPLSCLSPTKWSSVSSADSTEKSASAAGTRNLPFQFCLRQALRMKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGIFQINSFAWCRRGKLKENNHCHVACSALVTDDLTDAIICAKKIVKETQGMNYWQGWKKHCEGRDLSDWKKDCEVS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LYZL2 lysozyme-like 2 [ Homo sapiens (human) ] |
Official Symbol | LYZL2 |
Synonyms | LYZL2; lysozyme-like 2; lysozyme-like protein 2; lysozyme 2; lysozyme-2; EC 3.2.1.17 |
Gene ID | 119180 |
mRNA Refseq | NM_183058 |
Protein Refseq | NP_898881 |
MIM | 612748 |
UniProt ID | Q7Z4W2 |
◆ Recombinant Proteins | ||
LYZL2-4530H | Recombinant Human LYZL2 Protein, GST-tagged | +Inquiry |
LYZL2-6042HF | Recombinant Full Length Human LYZL2 Protein, GST-tagged | +Inquiry |
LYZL2-671H | Recombinant Human LYZL2, His-tagged | +Inquiry |
LYZL2-460H | Recombinant Human LYZL2, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LYZL2-001HCL | Recombinant Human LYZL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LYZL2 Products
Required fields are marked with *
My Review for All LYZL2 Products
Required fields are marked with *
0
Inquiry Basket