Recombinant Full Length Human LYZL6 Protein, GST-tagged
Cat.No. : | LYZL6-6045HF |
Product Overview : | Human LYZL6 full-length ORF ( NP_065159.1, 1 a.a. - 148 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 148 amino acids |
Description : | Lysozymes (see LYZ; MIM 153450), especially C-type lysozymes, are well-recognized bacteriolytic factors widely distributed in the animal kingdom and play a mainly protective role in host defense. LYZL6 is a member of a family of lysozyme-like genes (Zhang et al., 2005 [PubMed 16014814]).[supplied by OMIM |
Molecular Mass : | 43.4 kDa |
AA Sequence : | MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKINENADGSFDYGLFQINSHYWCNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRPLFYWLTGCRLR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LYZL6 lysozyme-like 6 [ Homo sapiens ] |
Official Symbol | LYZL6 |
Synonyms | LYC1; UNQ754; PRO1485; TKAL754; LYZL6; lysozyme-like 6 |
Gene ID | 57151 |
mRNA Refseq | NM_020426 |
Protein Refseq | NP_065159 |
MIM | 612751 |
UniProt ID | O75951 |
◆ Recombinant Proteins | ||
LYZL6-2434R | Recombinant Rhesus Macaque LYZL6 Protein, His (Fc)-Avi-tagged | +Inquiry |
LYZL6-2614R | Recombinant Rhesus monkey LYZL6 Protein, His-tagged | +Inquiry |
Lyzl6-3884M | Recombinant Mouse Lyzl6 Protein, Myc/DDK-tagged | +Inquiry |
LYZL6-6045HF | Recombinant Full Length Human LYZL6 Protein, GST-tagged | +Inquiry |
LYZL6-134H | Recombinant Human LYZL6, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LYZL6-4577HCL | Recombinant Human LYZL6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYZL6 Products
Required fields are marked with *
My Review for All LYZL6 Products
Required fields are marked with *