Recombinant Full Length Human LZIC Protein, GST-tagged
Cat.No. : | LZIC-6046HF |
Product Overview : | Human LZIC full-length ORF ( NP_115744.2, 1 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 190 amino acids |
Description : | LZIC (Leucine Zipper And CTNNBIP1 Domain Containing) is a Protein Coding gene. GO annotations related to this gene include beta-catenin binding. An important paralog of this gene is CTNNBIP1. |
Molecular Mass : | 47.9 kDa |
AA Sequence : | MASRGKTETSKLKQNLEEQLDRLMQQLQDLEECREELDTDEYEETKKETLEQLSEFNDSLKKIMSGNMTLVDELSGMQLAIQAAISQAFKTPEVIRLFAKKQPGQLRTRLAEMDRDLMVGKLERDLYTQQKVEILTALRKLGEKLTADDEAFLSANAGAILSQFEKVSTDLGSGDKILALASFEVEKTKK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LZIC leucine zipper and CTNNBIP1 domain containing [ Homo sapiens ] |
Official Symbol | LZIC |
Synonyms | LZIC; leucine zipper and CTNNBIP1 domain containing; protein LZIC; MGC15436; leucine zipper and CTNNBIP1 domain-containing protein; leucine zipper domain and ICAT homologous domain containing; leucine zipper and ICAT homologous domain-containing protein; |
Gene ID | 84328 |
mRNA Refseq | NM_032368 |
Protein Refseq | NP_115744 |
MIM | 610458 |
UniProt ID | Q8WZA0 |
◆ Recombinant Proteins | ||
LZIC-674H | Recombinant Human LZIC, His-tagged | +Inquiry |
LZIC-3523R | Recombinant Rat LZIC Protein | +Inquiry |
LZIC-409H | Recombinant Human leucine zipper and CTNNBIP1 domain containing, His-tagged | +Inquiry |
LZIC-3678H | Recombinant Human LZIC protein, GST-tagged | +Inquiry |
LZIC-4527H | Recombinant Human LZIC Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LZIC-4576HCL | Recombinant Human LZIC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LZIC Products
Required fields are marked with *
My Review for All LZIC Products
Required fields are marked with *