Recombinant Full Length Human LZIC Protein, GST-tagged

• Cat.No.: LZIC-6046HF
• Product Overview: Human LZIC full-length ORF ( NP_115744.2, 1 a.a. - 190 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 190 amino acids
• Description: LZIC (Leucine Zipper And CTNNBIP1 Domain Containing) is a Protein Coding gene. GO annotations related to this gene include beta-catenin binding. An important paralog of this gene is CTNNBIP1.
• Molecular Mass: 47.9 kDa
• AA Sequence: MASRGKTETSKLKQNLEEQLDRLMQQLQDLEECREELDTDEYEETKKETLEQLSEFNDSLKKIMSGNMTLVDELSGMQLAIQAAISQAFKTPEVIRLFAKKQPGQLRTRLAEMDRDLMVGKLERDLYTQQKVEILTALRKLGEKLTADDEAFLSANAGAILSQFEKVSTDLGSGDKILALASFEVEKTKK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LZIC leucine zipper and CTNNBIP1 domain containing [ Homo sapiens ]
• Official Symbol: LZIC
• Synonyms: LZIC; leucine zipper and CTNNBIP1 domain containing; protein LZIC; MGC15436; leucine zipper and CTNNBIP1 domain-containing protein; leucine zipper domain and ICAT homologous domain containing; leucine zipper and ICAT homologous domain-containing protein
• Gene ID: 84328
• mRNA Refseq: NM_032368
• Protein Refseq: NP_115744
• MIM: 610458
• UniProt ID: Q8WZA0