Recombinant Full Length Human M1AP Protein, C-Flag-tagged
Cat.No. : | M1AP-2195HFL |
Product Overview : | Recombinant Full Length Human M1AP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein that is likely to function in progression of meiosis. A similar protein in mouse plays a role in gametogenesis in both sexes. Alternate splicing results in multiple transcript variants encoding different isoforms. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 59.2 kDa |
AA Sequence : | MHPGRTTGKGPSTHTQIDQQPPRLLIVHIALPSWADICTNLCEALQNFFSLACSLMGPSRMSLFSLYMVQ DQHECILPFVQVKGNFARLQTCISELRMLQREGCFRSQGASLRLAVEDGLQQFKQYSRHVTTRAALTYTS LEITILTSQPGKEVVKQLEEGLKDTDLARVRRFQVVEVTKGILEHVDSASPVEDTSNDESSILGTDIDLQ TIDNDIVSMEIFFKAWLHNSGTDQEQIHLLLSSQCFSNISRPRDNPMCLKCDLQERLLCPSLLAGTADGS LRMDDPKGDFITLYQMASQSSASHYKLQVIKALKSSGLCESLTYGLPFILRPTSCWQLDWDELETNQQHF HALCHSLLKREWLLLAKGEPPGPGHSQRIPASTFYVIMPSHSLTLLVKAVATRELMLPSTFPLLPEDPHD DSLKNVESMLDSLELEPTYNPLHVQSHLYSHLSSIYAKPQGRLHPHWESRAPRKHPCKTGQLQTNRARAT VAPLPMTPVPGRASKMPAASKSSSDAFFLPSEWEKDPSRP myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | M1AP meiosis 1 associated protein [ Homo sapiens (human) ] |
Official Symbol | M1AP |
Synonyms | D6Mm5e; SPGF48; C2orf65; SPATA37 |
Gene ID | 130951 |
mRNA Refseq | NM_138804.5 |
Protein Refseq | NP_620159.2 |
MIM | 619098 |
UniProt ID | Q8TC57 |
◆ Recombinant Proteins | ||
M1AP-6202Z | Recombinant Zebrafish M1AP | +Inquiry |
M1AP-4648H | Recombinant Human M1AP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
M1AP-1334H | Recombinant Human M1AP Protein, His (Fc)-Avi-tagged | +Inquiry |
M1AP-2195HFL | Recombinant Full Length Human M1AP Protein, C-Flag-tagged | +Inquiry |
M1ap-492M | Recombinant Mouse M1ap Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All M1AP Products
Required fields are marked with *
My Review for All M1AP Products
Required fields are marked with *
0
Inquiry Basket