Recombinant Full Length Human MAGEA3 Protein, C-Flag-tagged
Cat.No. : | MAGEA3-391HFL |
Product Overview : | Recombinant Full Length Human MAGEA3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 34.6 kDa |
AA Sequence : | MPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVEVTLGEVPAAESPDPPQSPQGASS LPTTMNYPLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAELVHFLLLKYRAREPVTKAEMLGSVV GNWQYFFPVIFSKASSSLQLVFGIELMEVDPIGHLYIFATCLGLSYDGLLGDNQIMPKAGLLIIVLAIIA REGDCAPEEKIWEELSVLEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSDPACYEFLWGPRALVE TSYVKVLHHMVKISGGPHISYPPLHEWVLREGEETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | MAGEA3 MAGE family member A3 [ Homo sapiens (human) ] |
Official Symbol | MAGEA3 |
Synonyms | HIP8; HYPD; CT1.3; MAGE3; MAGEA6 |
Gene ID | 4102 |
mRNA Refseq | NM_005362.4 |
Protein Refseq | NP_005353.1 |
MIM | 300174 |
UniProt ID | P43357 |
◆ Recombinant Proteins | ||
MAGEA3-2837H | Recombinant Human Melanoma Antigen Family A, 3, His-tagged | +Inquiry |
MAGEA3-6580H | Recombinant Human MAGEA3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MAGEA3-3199H | Recombinant Human MAGEA3 protein, His&Myc-tagged | +Inquiry |
MAGEA3-187H | Recombinant Human MAGEA3 Protein, MYC/DDK-tagged | +Inquiry |
MAGEA3-391HFL | Recombinant Full Length Human MAGEA3 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAGEA3-2126HCL | Recombinant Human MAGEA3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAGEA3 Products
Required fields are marked with *
My Review for All MAGEA3 Products
Required fields are marked with *
0
Inquiry Basket