Recombinant Full Length Human MAGOHB Protein, GST-tagged

Cat.No. : MAGOHB-4833HF
Product Overview : Human FLJ10292 full-length ORF ( NP_060518.1, 1 a.a. - 148 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 148 amino acids
Description : MAGOHB (Mago Homolog B, Exon Junction Complex Core Component) is a Protein Coding gene. Among its related pathways are mRNA Splicing - Major Pathway and Gene Expression. GO annotations related to this gene include poly(A) RNA binding. An important paralog of this gene is MAGOH.
Molecular Mass : 43.7 kDa
AA Sequence : MAVASDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MAGOHB mago homolog B, exon junction complex subunit [ Homo sapiens (human) ]
Official Symbol MAGOHB
Synonyms MAGOHB; mago-nashi homolog B (Drosophila); protein mago nashi homolog 2; FLJ10292; MGN2; mago-nashi homolog 2; mago; magoh;
Gene ID 55110
mRNA Refseq NM_018048
Protein Refseq NP_060518
MIM 619552
UniProt ID Q96A72

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAGOHB Products

Required fields are marked with *

My Review for All MAGOHB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon