Recombinant Full Length Human MAGOHB Protein, GST-tagged

• Cat.No.: MAGOHB-4833HF
• Product Overview: Human FLJ10292 full-length ORF ( NP_060518.1, 1 a.a. - 148 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 148 amino acids
• Description: MAGOHB (Mago Homolog B, Exon Junction Complex Core Component) is a Protein Coding gene. Among its related pathways are mRNA Splicing - Major Pathway and Gene Expression. GO annotations related to this gene include poly(A) RNA binding. An important paralog of this gene is MAGOH.
• Molecular Mass: 43.7 kDa
• AA Sequence: MAVASDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MAGOHB mago homolog B, exon junction complex subunit [ Homo sapiens (human) ]
• Official Symbol: MAGOHB
• Synonyms: MAGOHB; mago-nashi homolog B (Drosophila); protein mago nashi homolog 2; FLJ10292; MGN2; mago-nashi homolog 2; mago; magoh
• Gene ID: 55110
• mRNA Refseq: NM_018048
• Protein Refseq: NP_060518
• MIM: 619552
• UniProt ID: Q96A72