Recombinant Full Length Human MAGOHB Protein, GST-tagged
Cat.No. : | MAGOHB-4833HF |
Product Overview : | Human FLJ10292 full-length ORF ( NP_060518.1, 1 a.a. - 148 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 148 amino acids |
Description : | MAGOHB (Mago Homolog B, Exon Junction Complex Core Component) is a Protein Coding gene. Among its related pathways are mRNA Splicing - Major Pathway and Gene Expression. GO annotations related to this gene include poly(A) RNA binding. An important paralog of this gene is MAGOH. |
Molecular Mass : | 43.7 kDa |
AA Sequence : | MAVASDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MAGOHB mago homolog B, exon junction complex subunit [ Homo sapiens (human) ] |
Official Symbol | MAGOHB |
Synonyms | MAGOHB; mago-nashi homolog B (Drosophila); protein mago nashi homolog 2; FLJ10292; MGN2; mago-nashi homolog 2; mago; magoh; |
Gene ID | 55110 |
mRNA Refseq | NM_018048 |
Protein Refseq | NP_060518 |
MIM | 619552 |
UniProt ID | Q96A72 |
◆ Recombinant Proteins | ||
MAGOHB-7620H | Recombinant Human MAGOHB, His-tagged | +Inquiry |
MAGOHB-2453R | Recombinant Rhesus Macaque MAGOHB Protein, His (Fc)-Avi-tagged | +Inquiry |
MAGOHB-5304M | Recombinant Mouse MAGOHB Protein, His (Fc)-Avi-tagged | +Inquiry |
MAGOHB-9466M | Recombinant Mouse MAGOHB Protein | +Inquiry |
MAGOHB-4213H | Recombinant Human MAGOHB Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAGOHB-4533HCL | Recombinant Human MAGOHB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAGOHB Products
Required fields are marked with *
My Review for All MAGOHB Products
Required fields are marked with *
0
Inquiry Basket