Recombinant Full Length Human MAP2K2 Protein, C-Flag-tagged
Cat.No. : | MAP2K2-1645HFL |
Product Overview : | Recombinant Full Length Human MAP2K2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is known to play a critical role in mitogen growth factor signal transduction. It phosphorylates and thus activates MAPK1/ERK2 and MAPK2/ERK3. The activation of this kinase itself is dependent on the Ser/Thr phosphorylation by MAP kinase kinase kinases. Mutations in this gene cause cardiofaciocutaneous syndrome (CFC syndrome), a disease characterized by heart defects, cognitive disability, and distinctive facial features similar to those found in Noonan syndrome. The inhibition or degradation of this kinase is also found to be involved in the pathogenesis of Yersinia and anthrax. A pseudogene, which is located on chromosome 7, has been identified for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 44.2 kDa |
AA Sequence : | MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEELELDEQQKKRLEAFLTQKAKVGELKDD DFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSD GEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRGLAYLREKHQIMHRDVKPSNILVNSRGEIKL CDFGVSGQLIDSMANSFVGTRSYMAPERLQGTHYSVQSDIWSMGLSLVELAVGRYPIPPPDAKELEAIFG RPVVDGEEGEPHSISPRPRPPGRPVSGHGMDSRPAMAIFELLDYIVNEPPPKLPNGVFTPDFQEFVNKCL IKNPAERADLKMLTNHTFIKRSEVEEVDFAGWLCKTLRLNQPGTPTRTAVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Protein Pathways : | Acute myeloid leukemia, B cell receptor signaling pathway, Bladder cancer, Chronic myeloid leukemia, Endometrial cancer, ErbB signaling pathway, Fc epsilon RI signaling pathway, Gap junction, Glioma, GnRH signaling pathway, Insulin signaling pathway, Long-term depression, Long-term potentiation, MAPK signaling pathway, Melanogenesis, Melanoma, Natural killer cell mediated cytotoxicity, Neurotrophin signaling pathway, Non-small cell lung cancer, Pathways in cancer, Prion diseases, Prostate cancer, Regulation of actin cytoskeleton, Renal cell carcinoma, T cell receptor signaling pathway, Thyroid cancer, Toll-like receptor signaling pathway, Vascular smooth muscle contraction, VEGF signaling pathway |
Full Length : | Full L. |
Gene Name | MAP2K2 mitogen-activated protein kinase kinase 2 [ Homo sapiens (human) ] |
Official Symbol | MAP2K2 |
Synonyms | CFC4; MEK2; MKK2; MAPKK2; PRKMK2 |
Gene ID | 5605 |
mRNA Refseq | NM_030662.4 |
Protein Refseq | NP_109587.1 |
MIM | 601263 |
UniProt ID | P36507 |
◆ Recombinant Proteins | ||
MAP2K2-5651HF | Active Recombinant Full Length Human MAP2K2 Protein, GST-tagged | +Inquiry |
MAP2K2-4024H | Recombinant Human MAP2K2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MAP2K2-968HAF647 | Recombinant Human MAP2K2 Protein, GST-tagged, Alexa Fluor 647 conjugated | +Inquiry |
MAP2K2-29202TH | Recombinant Human MAP2K2 | +Inquiry |
MAP2K2-107HFL | Unactive Recombinant Full Length Human MAP2K2 Protein, N-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAP2K2-613HCL | Recombinant Human MAP2K2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAP2K2 Products
Required fields are marked with *
My Review for All MAP2K2 Products
Required fields are marked with *
0
Inquiry Basket