Recombinant Full Length Human MAP2K5 Protein
Cat.No. : | MAP2K5-295HF |
Product Overview : | Recombinant full length Human MEK5 with N terminal proprietary tag; predicted MWt 75.02 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase specifically interacts with and activates MAPK7/ERK5. This kinase itself can be phosphorylated and activated by MAP3K3/MEKK3, as well as by atypical protein kinase C isoforms (aPKCs). The signal cascade mediated by this kinase is involved in growth factor stimulated cell proliferation and muscle cell differentiation. Three alternatively spliced transcript variants of this gene encoding distinct isoforms have been described. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 75.020kDa inclusive of tags |
Protein Length : | 448 amino acids |
AA Sequence : | MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLL FRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKA MLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGL KVNTRAGPSQHSSPAVSDSLPSNSLKKSSAELKKILANGQ MNEQDIRYRDTLGHGNGGTVYKAYHVPSGKILAVKVILLD ITLELQKQIMSELEILYKCDSSYIIGFYGAFFVENRISIC TEFMDGGSLDVYRKMPEHVLGRIAVAVVKGLTYLWSLKIL HRDVKPSNMLVNTRGQVKLCDFGVSTQLVNSIAKTYVGTN AYMAPERISGEQYGIHSDVWSLGISFMELALGRFPYPQIQ KNQGSLMPLQLLQCIVDEDSPVLPVGESSEPFVHFITQCM RKQPKERPAPEELMGHPFIVQFNDGNAAVVSMWVCRALEE RRSQQGPP |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | MAP2K5 mitogen-activated protein kinase kinase 5 [ Homo sapiens ] |
Official Symbol : | MAP2K5 |
Synonyms : | MAP2K5; mitogen-activated protein kinase kinase 5; PRKMK5; dual specificity mitogen-activated protein kinase kinase 5; HsT17454; MAPKK5; MEK5 |
Gene ID : | 5607 |
mRNA Refseq : | NM_001206804 |
Protein Refseq : | NP_001193733 |
MIM : | 602520 |
UniProt ID : | Q13163 |
Products Types
◆ Recombinant Protein | ||
MAP2K5-3217R | Recombinant Rat MAP2K5 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAP2K5-422C | Recombinant Cynomolgus Monkey MAP2K5 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAP2K5-001H | Recombinant Human MAP2K5 Protein, GST-tagged | +Inquiry |
MAP2K5-3431H | Recombinant Human MAP2K5 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAP2K5-003H | Recombinant Human MAP2K5 Protein, GST-tagged | +Inquiry |
◆ Lysates | ||
MAP2K5-4509HCL | Recombinant Human MAP2K5 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Reviews
- Q&As
Ask a Question for All MAP2K5 Products
Required fields are marked with *
My Review for All MAP2K5 Products
Required fields are marked with *
0
Inquiry Basket