Recombinant Full Length Human MAP2K7 Protein, C-Flag-tagged
Cat.No. : | MAP2K7-1511HFL |
Product Overview : | Recombinant Full Length Human MAP2K7 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase specifically activates MAPK8/JNK1 and MAPK9/JNK2, and this kinase itself is phosphorylated and activated by MAP kinase kinase kinases including MAP3K1/MEKK1, MAP3K2/MEKK2,MAP3K3/MEKK5, and MAP4K2/GCK. This kinase is involved in the signal transduction mediating the cell responses to proinflammatory cytokines, and environmental stresses. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 47.3 kDa |
AA Sequence : | MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLANDGGSRSPSSESSPQHPTPPAR PRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFR KTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRM QGPIPERILGKMTVAIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGC AAYMAPERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFS GDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSGVLSQPHLPFFRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Protein Pathways : | ErbB signaling pathway, Fc epsilon RI signaling pathway, GnRH signaling pathway, MAPK signaling pathway, Neurotrophin signaling pathway, T cell receptor signaling pathway, Toll-like receptor signaling pathway |
Full Length : | Full L. |
Gene Name | MAP2K7 mitogen-activated protein kinase kinase 7 [ Homo sapiens (human) ] |
Official Symbol | MAP2K7 |
Synonyms | MEK; MKK7; JNKK2; MEK 7; MAPKK7; PRKMK7; SAPKK4; SAPKK-4 |
Gene ID | 5609 |
mRNA Refseq | NM_145185.4 |
Protein Refseq | NP_660186.1 |
MIM | 603014 |
UniProt ID | O14733 |
◆ Recombinant Proteins | ||
MAP2K7-8083H | Recombinant Human MAP2K7 protein, His & T7-tagged | +Inquiry |
MAP2K7-2337HF | Active Recombinant Full Length Human MAP2K7 Protein, GST-tagged | +Inquiry |
MAP2K7-0395H | Recombinant Human MAP2K7 Protein (A2-R419), His/GST tagged | +Inquiry |
MAP2K7-1511HFL | Recombinant Full Length Human MAP2K7 Protein, C-Flag-tagged | +Inquiry |
MAP2K7-5009H | Recombinant Human MAP2K7 Protein (Thr103-Arg419), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAP2K7-4508HCL | Recombinant Human MAP2K7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAP2K7 Products
Required fields are marked with *
My Review for All MAP2K7 Products
Required fields are marked with *
0
Inquiry Basket