Recombinant Full Length Human MAP4 Protein
Cat.No. : | MAP4-292HF |
Product Overview : | Recombinant full length Human MAP4 (aa 1-99) with N-terminal proprietary tag, 36.96 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 99 amino acids |
Description : | The protein encoded by this gene is a major non-neuronal microtubule-associated protein. This protein contains a domain similar to the microtubule-binding domains of neuronal microtubule-associated protein (MAP2) and microtubule-associated protein tau (MAPT/TAU). This protein promotes microtubule assembly, and has been shown to counteract destabilization of interphase microtubule catastrophe promotion. Cyclin B was found to interact with this protein, which targets cell division cycle 2 (CDC2) kinase to microtubules. The phosphorylation of this protein affects microtubule properties and cell cycle progression. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | Liquid |
Molecular Mass : | 36.960kDa inclusive of tags |
AA Sequence : | MADLSLADALTEPSPDIEGEIKRDFIATLEAEAFDDVVGETVGKTDYIPLLDVDEKTGNSESKKKPCSETSQIEDTPSSKPTLLANGGHGVEGSDTTEA |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | MAP4 microtubule-associated protein 4 [ Homo sapiens ] |
Official Symbol | MAP4 |
Synonyms | MAP4; microtubule-associated protein 4 |
Gene ID | 4134 |
mRNA Refseq | NM_001134364 |
Protein Refseq | NP_001127836 |
MIM | 157132 |
UniProt ID | P27816 |
◆ Recombinant Proteins | ||
Map4-6807M | Recombinant Mouse Map4 protein, His-tagged | +Inquiry |
MAP4-5337M | Recombinant Mouse MAP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAP4-2670R | Recombinant Rhesus monkey MAP4 Protein, His-tagged | +Inquiry |
Map4-6808R | Recombinant Rat Map4 protein, His & T7-tagged | +Inquiry |
MAP4-3224R | Recombinant Rat MAP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAP4-4503HCL | Recombinant Human MAP4 293 Cell Lysate | +Inquiry |
MAP4-4502HCL | Recombinant Human MAP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAP4 Products
Required fields are marked with *
My Review for All MAP4 Products
Required fields are marked with *