Recombinant Full Length Human MAP4 Protein

Cat.No. : MAP4-292HF
Product Overview : Recombinant full length Human MAP4 (aa 1-99) with N-terminal proprietary tag, 36.96 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 99 amino acids
Description : The protein encoded by this gene is a major non-neuronal microtubule-associated protein. This protein contains a domain similar to the microtubule-binding domains of neuronal microtubule-associated protein (MAP2) and microtubule-associated protein tau (MAPT/TAU). This protein promotes microtubule assembly, and has been shown to counteract destabilization of interphase microtubule catastrophe promotion. Cyclin B was found to interact with this protein, which targets cell division cycle 2 (CDC2) kinase to microtubules. The phosphorylation of this protein affects microtubule properties and cell cycle progression. Multiple transcript variants encoding different isoforms have been found for this gene.
Form : Liquid
Molecular Mass : 36.960kDa inclusive of tags
AA Sequence : MADLSLADALTEPSPDIEGEIKRDFIATLEAEAFDDVVGETVGKTDYIPLLDVDEKTGNSESKKKPCSETSQIEDTPSSKPTLLANGGHGVEGSDTTEA
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name MAP4 microtubule-associated protein 4 [ Homo sapiens ]
Official Symbol MAP4
Synonyms MAP4; microtubule-associated protein 4
Gene ID 4134
mRNA Refseq NM_001134364
Protein Refseq NP_001127836
MIM 157132
UniProt ID P27816

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAP4 Products

Required fields are marked with *

My Review for All MAP4 Products

Required fields are marked with *

0
cart-icon
0
compare icon