Recombinant Full Length Human MAPRE1 Protein, C-Flag-tagged
Cat.No. : | MAPRE1-1486HFL |
Product Overview : | Recombinant Full Length Human MAPRE1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene was first identified by its binding to the APC protein which is often mutated in familial and sporadic forms of colorectal cancer. This protein localizes to microtubules, especially the growing ends, in interphase cells. During mitosis, the protein is associated with the centrosomes and spindle microtubules. The protein also associates with components of the dynactin complex and the intermediate chain of cytoplasmic dynein. Because of these associations, it is thought that this protein is involved in the regulation of microtubule structures and chromosome stability. This gene is a member of the RP/EB family. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 29.8 kDa |
AA Sequence : | MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHE YIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAARQGQETAVAPS LVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDL EKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | MAPRE1 microtubule associated protein RP/EB family member 1 [ Homo sapiens (human) ] |
Official Symbol | MAPRE1 |
Synonyms | EB1 |
Gene ID | 22919 |
mRNA Refseq | NM_012325.3 |
Protein Refseq | NP_036457.1 |
MIM | 603108 |
UniProt ID | Q15691 |
◆ Recombinant Proteins | ||
MAPRE1-465H | Recombinant Human MAPRE1 Protein, DDK-tagged | +Inquiry |
MAPRE1-29128TH | Recombinant Human MAPRE1, His-tagged | +Inquiry |
MAPRE1-6355H | Recombinant Human MAPRE1 protein, His-tagged | +Inquiry |
MAPRE1-3376H | Recombinant Human MAPRE1, His-tagged | +Inquiry |
MAPRE1-2554C | Recombinant Chicken MAPRE1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAPRE1-4481HCL | Recombinant Human MAPRE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MAPRE1 Products
Required fields are marked with *
My Review for All MAPRE1 Products
Required fields are marked with *
0
Inquiry Basket