Recombinant Full Length Human MARVELD2 Protein, C-Flag-tagged
Cat.No. : | MARVELD2-1241HFL |
Product Overview : | Recombinant Full Length Human MARVELD2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is a membrane protein found at the tight junctions between epithelial cells. The encoded protein helps establish epithelial barriers such as those in the organ of Corti, where these barriers are required for normal hearing. Defects in this gene are a cause of deafness autosomal recessive type 49 (DFNB49). Two transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 64 kDa |
AA Sequence : | MSNDGRSRNRDRRYDEVPSDLPYQDTTIRTHPILHDSERAVSADPLPPPPLPLQPPFGPDFYSSDTEEPA IAPDLKPVRRFVPDSWKNFFRGKKKDPEWDKPVSDIRYISDGVECSPPASPARPNHRSPLNSCKDPYGGS EGTFSSRKEADAVFPRDPYGSLDRHTQTVRTYSEKVEEYNLRYSYMKSWAGLLRILGVVELLLGAGVFAC VTAYIHKDSEWYNLFGYSQPYGMGGVGGLGSMYGGYYYTGPKTPFVLVVAGLAWITTIIILVLGMSMYYR TILLDSNWWPLTEFGINVALFILYMAAAIVYVNDTNRGGLCYYPLFNTPVNAVFCRVEGGQIAAMIFLFV TMIVYLISALVCLKLWRHEAARRHREYMEQQEINEPSLSSKRKMCEMATSGDRQRDSEVNFKELRTAKMK PELLSGHIPPGHIPKPIVMPDYVAKYPVIQTDDERERYKAVFQDQFSEYKELSAEVQAVLRKFDELDAVM SRLPHHSESRQEHERISRIHEEFKKKKNDPTFLEKKERCDYLKNKLSHIKQRIQEYDKVMNWDVQGYSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Full Length : | Full L. |
Gene Name | MARVELD2 MARVEL domain containing 2 [ Homo sapiens (human) ] |
Official Symbol | MARVELD2 |
Synonyms | Tric; DFNB49; MARVD2; MRVLDC2 |
Gene ID | 153562 |
mRNA Refseq | NM_001038603.3 |
Protein Refseq | NP_001033692.2 |
MIM | 610572 |
UniProt ID | Q8N4S9 |
◆ Recombinant Proteins | ||
Marveld2-3965M | Recombinant Mouse Marveld2 Protein, Myc/DDK-tagged | +Inquiry |
MARVELD2-301480H | Recombinant Human MARVELD2 protein, GST-tagged | +Inquiry |
MARVELD2-1241HFL | Recombinant Full Length Human MARVELD2 Protein, C-Flag-tagged | +Inquiry |
RFL5805XF | Recombinant Full Length Xenopus Tropicalis Marvel Domain-Containing Protein 2(Marveld2) Protein, His-Tagged | +Inquiry |
RFL36027MF | Recombinant Full Length Mouse Marvel Domain-Containing Protein 2(Marveld2) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MARVELD2-4462HCL | Recombinant Human MARVELD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MARVELD2 Products
Required fields are marked with *
My Review for All MARVELD2 Products
Required fields are marked with *
0
Inquiry Basket