Recombinant Full Length Human MCAM Protein, C-Flag-tagged
Cat.No. : | MCAM-887HFL |
Product Overview : | Recombinant Full Length Human MCAM Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Involved in glomerular filtration and vascular wound healing. Acts upstream of or within angiogenesis. Located in external side of plasma membrane. Biomarker of chronic obstructive pulmonary disease and uveal melanoma. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 71.4 kDa |
AA Sequence : | MGLPRLVCAFLLAACCCCPRVAGVPGEAEQPAPELVEVEVGSTALLKCGLSQSQGNLSHVDWFSVHKEKR TLIFRVRQGQGQSEPGEYEQRLSLQDRGATLALTQVTPQDERIFLCQGKRPRSQEYRIQLRVYKAPEEPN IQVNPLGIPVNSKEPEEVATCVGRNGYPIPQVIWYKNGRPLKEEKNRVHIQSSQTVESSGLYTLQSILKA QLVKEDKDAQFYCELNYRLPSGNHMKESREVTVPVFYPTEKVWLEVEPVGMLKEGDRVEIRCLADGNPPP HFSISKQNPSTREAEEETTNDNGVLVLEPARKEHSGRYECQGLDLDTMISLLSEPQELLVNYVSDVRVSP AAPERQEGSSLTLTCEAESSQDLEFQWLREETGQVLERGPVLQLHDLKREAGGGYRCVASVPSIPGLNRT QLVNVAIFGPPWMAFKERKVWVKENMVLNLSCEASGHPRPTISWNVNGTASEQDQDPQRVLSTLNVLVTP ELLETGVECTASNDLGKNTSILFLELVNLTTLTPDSNTTTGLSTSTASPHTRANSTSTERKLPEPESRGV VIVAVIVCILVLAVLGAVLYFLYKKGKLPCRRSGKQEITLPPSRKSELVVEVKSDKLPEEMGLLQGSSGD KRAPGDQGEKYIDLRHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Full Length : | Full L. |
Gene Name | MCAM melanoma cell adhesion molecule [ Homo sapiens (human) ] |
Official Symbol | MCAM |
Synonyms | CD146; MUC18; HEMCAM; METCAM; MelCAM |
Gene ID | 4162 |
mRNA Refseq | NM_006500.3 |
Protein Refseq | NP_006491.2 |
MIM | 155735 |
UniProt ID | P43121 |
◆ Recombinant Proteins | ||
MCAM-1380H | Recombinant Human MCAM Protein, His (Fc)-Avi-tagged | +Inquiry |
MCAM-4514H | Recombinant Human MCAM Protein (Met1-Gly559), C-His tagged | +Inquiry |
MCAM-887HFL | Recombinant Full Length Human MCAM Protein, C-Flag-tagged | +Inquiry |
Mcam-1783M | Recombinant Mouse Mcam protein, His-tagged | +Inquiry |
MCAM-5261H | Recombinant Human MCAM protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MCAM-2742HCL | Recombinant Human MCAM cell lysate | +Inquiry |
MCAM-1713MCL | Recombinant Mouse MCAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MCAM Products
Required fields are marked with *
My Review for All MCAM Products
Required fields are marked with *
0
Inquiry Basket