Recombinant Full Length Human MCHR1 Protein, GST-tagged

Cat.No. : MCHR1-5508HF
Product Overview : Human GPR24 full-length ORF ( AAH01736, 1 a.a. - 422 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 422 amino acids
Description : The protein encoded by this gene, a member of the G protein-coupled receptor family 1, is an integral plasma membrane protein which binds melanin-concentrating hormone. The encoded protein can inhibit cAMP accumulation and stimulate intracellular calcium flux, and is probably involved in the neuronal regulation of food consumption. Although structurally similar to somatostatin receptors, this protein does not seem to bind somatostatin. [provided by RefSeq
Molecular Mass : 71.94 kDa
AA Sequence : MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPDCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQLTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTLVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MCHR1 melanin-concentrating hormone receptor 1 [ Homo sapiens ]
Official Symbol MCHR1
Synonyms MCHR1; melanin-concentrating hormone receptor 1; G protein coupled receptor 24, GPR24; MCH1R; SLC1; SLC-1; MCH-1R; MCH receptor 1; G protein-coupled receptor 24; somatostatin receptor-like protein; GPR24; MGC32129;
Gene ID 2847
mRNA Refseq NM_005297
Protein Refseq NP_005288
MIM 601751
UniProt ID Q99705

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MCHR1 Products

Required fields are marked with *

My Review for All MCHR1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon