Recombinant Full Length Human MCM7 Protein, C-Flag-tagged
Cat.No. : | MCM7-663HFL |
Product Overview : | Recombinant Full Length Human MCM7 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. The MCM complex consisting of this protein and MCM2, 4 and 6 proteins possesses DNA helicase activity, and may act as a DNA unwinding enzyme. Cyclin D1-dependent kinase, CDK4, is found to associate with this protein, and may regulate the binding of this protein with the tumorsuppressor protein RB1/RB. Alternatively spliced transcript variants encoding distinct isoforms have been reported. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 81.1 kDa |
AA Sequence : | MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYVDLDDVAEDDPELVDSICENA RRYAKLFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRDPGMVRSPQNQYPAELMRRFELYFQG PSSNKPRVIREVRADSVGKLVTVRGIVTRVSEVKPKMVVATYTCDQCGAETYQPIQSPTFMPLIMCPSQE CQTNRSGGRLYLQTRGSRFIKFQEMKMQEHSDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPI LRTGFRQVVQGLLSETYLEAHRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDV KKALLLLLVGGVDQSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLR DSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNARCSILAAANP AYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYVHQHSRQPPSQFEPLDMKLMR RYIAMCREKQPMVPESLADYITAAYVEMRREAWASKDATYTSARTLLAILRLSTALARLRMVDVVEKEDV NEAIRLMEMSKDSLLGDKGQTARTQRPADVIFATVRELVSGGRSVRFSEAEQRCVSRGFTPAQFQAALDE YEELNVWQVNASRTRITFVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Protein Pathways : | Cell cycle, DNA replication |
Full Length : | Full L. |
Gene Name | MCM7 minichromosome maintenance complex component 7 [ Homo sapiens (human) ] |
Official Symbol | MCM7 |
Synonyms | MCM2; CDC47; P85MCM; P1CDC47; PNAS146; PPP1R104; P1.1-MCM3 |
Gene ID | 4176 |
mRNA Refseq | NM_005916.5 |
Protein Refseq | NP_005907.3 |
MIM | 600592 |
UniProt ID | P33993 |
◆ Recombinant Proteins | ||
MCM7-01H | Recombinant Human MCM7 Protein, Myc/DDK-tagged | +Inquiry |
Mcm7-3998M | Recombinant Mouse Mcm7 Protein, Myc/DDK-tagged | +Inquiry |
MCM7-427H | Recombinant Human minichromosome maintenance complex component 7, His-tagged | +Inquiry |
MCM7-4517H | Recombinant Human MCM7 Protein, GST-tagged | +Inquiry |
MCM7-6072HF | Recombinant Full Length Human MCM7 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MCM7-4415HCL | Recombinant Human MCM7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MCM7 Products
Required fields are marked with *
My Review for All MCM7 Products
Required fields are marked with *
0
Inquiry Basket