Recombinant Full Length Human MDH1 Protein, GST-tagged
Cat.No. : | MDH1-6102HF |
Product Overview : | Human MDH1 full-length ORF ( AAH01484.1, 1 a.a. - 334 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 334 amino acids |
Description : | Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. [provided by RefSeq |
Molecular Mass : | 62.48 kDa |
AA Sequence : | MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MDH1 malate dehydrogenase 1, NAD (soluble) [ Homo sapiens ] |
Official Symbol | MDH1 |
Synonyms | MDH1; malate dehydrogenase 1, NAD (soluble); malate dehydrogenase, cytoplasmic; soluble malate dehydrogenase; cytosolic malate dehydrogenase; MDHA; MOR2; MDH-s; MGC:1375; |
Gene ID | 4190 |
mRNA Refseq | NM_001199111 |
Protein Refseq | NP_001186040 |
MIM | 154200 |
UniProt ID | P40925 |
◆ Recombinant Proteins | ||
MDH1-1537C | Recombinant Chicken MDH1 | +Inquiry |
MDH1-3628R | Recombinant Rat MDH1 Protein | +Inquiry |
MDH1-4524H | Recombinant Human MDH1 Protein (Ser2-Ala334), N-GST tagged | +Inquiry |
Mdh1-1770R | Recombinant Rat Mdh1 Protein, His&GST-tagged | +Inquiry |
MDH1-3284R | Recombinant Rat MDH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MDH1-4409HCL | Recombinant Human MDH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MDH1 Products
Required fields are marked with *
My Review for All MDH1 Products
Required fields are marked with *
0
Inquiry Basket