Recombinant Full Length Human MED11 Protein, GST-tagged
Cat.No. : | MED11-6130HF |
Product Overview : | Human MED11 full-length ORF (AAH70377.1, 1 a.a. - 117 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 117 amino acids |
Description : | MED11 is a component of the Mediator complex, which is a coactivator for DNA-binding factors that activate transcription via RNA polymerase II (Sato et al., 2003 [PubMed 12584197]).[supplied by OMIM |
Molecular Mass : | 39.5 kDa |
AA Sequence : | MATYSLANERLRALEDIEREIGAILQNAGTVILELSKEKTNERLLDRQAAAFTASVQHVEAELSAQIRYLTQVATGQPHEGSSYSSRKDCQMALKRVDYARLKLSDVARTCEQMLEN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MED11 mediator complex subunit 11 [ Homo sapiens (human) ] |
Official Symbol | MED11 |
Synonyms | MED11; mediator complex subunit 11; HSPC296; mediator of RNA polymerase II transcription subunit 11; mediator of RNA polymerase II transcription, subunit 11 homolog |
Gene ID | https://www.ncbi.nlm.nih.gov/gene/?term=400569 |
mRNA Refseq | NM_001001683 |
Protein Refseq | NP_001001683 |
MIM | 612383 |
UniProt ID | Q9P086 |
◆ Recombinant Proteins | ||
MED11-2537R | Recombinant Rhesus Macaque MED11 Protein, His (Fc)-Avi-tagged | +Inquiry |
MED11-5442M | Recombinant Mouse MED11 Protein, His (Fc)-Avi-tagged | +Inquiry |
MED11-7468Z | Recombinant Zebrafish MED11 | +Inquiry |
MED11-2717R | Recombinant Rhesus monkey MED11 Protein, His-tagged | +Inquiry |
MED11-4480H | Recombinant Human MED11 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MED11 Products
Required fields are marked with *
My Review for All MED11 Products
Required fields are marked with *
0
Inquiry Basket