Recombinant Full Length Human MED22 Protein, GST-tagged
| Cat.No. : | MED22-6215HF |
| Product Overview : | Human MED22 full-length ORF ( NP_852468.1, 1 a.a. - 140 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 140 amino acids |
| Description : | This gene is located in the surfeit gene cluster, a group of very tightly linked housekeeping genes that do not share sequence similarity. The gene is oriented in a head-to-head fashion with RPL7A (SURF3) and the two genes share a bidirectional promoter. The encoded proteins are localized to the cytoplasm. Two alternative transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq |
| Molecular Mass : | 42.9 kDa |
| AA Sequence : | MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLRDEISIDLYELEEEYYSSRYK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MED22 mediator complex subunit 22 [ Homo sapiens ] |
| Official Symbol | MED22 |
| Synonyms | MED22; mediator complex subunit 22; SURF5, surfeit 5; mediator of RNA polymerase II transcription subunit 22; Med24; surfeit 5; surfeit locus protein 5; MED24; SURF5; surf-5; MGC48682; |
| Gene ID | 6837 |
| mRNA Refseq | NM_133640 |
| Protein Refseq | NP_598395 |
| MIM | 185641 |
| UniProt ID | Q15528 |
| ◆ Recombinant Proteins | ||
| MED22-2721R | Recombinant Rhesus monkey MED22 Protein, His-tagged | +Inquiry |
| MED22-3636R | Recombinant Rat MED22 Protein | +Inquiry |
| Med22-4015M | Recombinant Mouse Med22 Protein, Myc/DDK-tagged | +Inquiry |
| MED22-6215HF | Recombinant Full Length Human MED22 Protein, GST-tagged | +Inquiry |
| MED22-4473H | Recombinant Human MED22 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MED22-4387HCL | Recombinant Human MED22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MED22 Products
Required fields are marked with *
My Review for All MED22 Products
Required fields are marked with *
