Recombinant Human MED22 protein, His-tagged
| Cat.No. : | MED22-3382H |
| Product Overview : | Recombinant Human MED22 protein(1-140 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 08, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-140 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYEMHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLRDEISIDLYELEEEYYSSRYK |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | MED22 mediator complex subunit 22 [ Homo sapiens ] |
| Official Symbol | MED22 |
| Synonyms | MED22; mediator complex subunit 22; SURF5, surfeit 5; mediator of RNA polymerase II transcription subunit 22; Med24; surfeit 5; surfeit locus protein 5; MED24; SURF5; surf-5; MGC48682; |
| Gene ID | 6837 |
| mRNA Refseq | NM_133640 |
| Protein Refseq | NP_598395 |
| MIM | 185641 |
| UniProt ID | Q15528 |
| ◆ Recombinant Proteins | ||
| MED22-3636R | Recombinant Rat MED22 Protein | +Inquiry |
| MED22-369Z | Recombinant Zebrafish MED22 | +Inquiry |
| MED22-3382H | Recombinant Human MED22 protein, His-tagged | +Inquiry |
| Med22-4015M | Recombinant Mouse Med22 Protein, Myc/DDK-tagged | +Inquiry |
| MED22-5451M | Recombinant Mouse MED22 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MED22-4387HCL | Recombinant Human MED22 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MED22 Products
Required fields are marked with *
My Review for All MED22 Products
Required fields are marked with *
