Recombinant Full Length Human MEI1 Protein, GST-tagged
| Cat.No. : | MEI1-6125HF |
| Product Overview : | Human MEI1 full-length ORF ( AAH32248.1, 1 a.a. - 238 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 238 amino acids |
| Description : | MEI1 (Meiotic Double-Stranded Break Formation Protein 1) is a Protein Coding gene. GO annotations related to this gene include binding. |
| Molecular Mass : | 52 kDa |
| AA Sequence : | MLALTLAKADSPRTALLCSAWLLTASFSAQQHKGSLQVHQTLSVEMDQVLKALSFPKKKAALLSAAILCFLRTALRQSFSSALVALVPSGAQPLPATKDTVLAPLRMSQVRSLVIGLQNLLVQKDPLLSQACVGCLEALLDYLDARSPDIALHVASQPWNRFLLFTLLDAGENSFLRPEILRLMTLLQSMGHLADHSMAQTLQASLEGLPPSTSSGQPPLQDMLCLGGVAVSLSHIRN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MEI1 meiosis inhibitor 1 [ Homo sapiens ] |
| Official Symbol | MEI1 |
| Synonyms | MEI1; meiosis inhibitor 1; meiosis inhibitor protein 1; MGC40042; meiosis defective 1; meiosis defective protein 1; |
| Gene ID | 150365 |
| mRNA Refseq | NM_152513 |
| Protein Refseq | NP_689726 |
| MIM | 608797 |
| UniProt ID | Q5TIA1 |
| ◆ Recombinant Proteins | ||
| MEI1-6125HF | Recombinant Full Length Human MEI1 Protein, GST-tagged | +Inquiry |
| MEI1-4453H | Recombinant Human MEI1 Protein, GST-tagged | +Inquiry |
| MEI1-9718M | Recombinant Mouse MEI1 Protein | +Inquiry |
| MEI1-5467M | Recombinant Mouse MEI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MEI1-1076HCL | Recombinant Human MEI1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MEI1 Products
Required fields are marked with *
My Review for All MEI1 Products
Required fields are marked with *
