Recombinant Full Length Human MEI1 Protein, GST-tagged

Cat.No. : MEI1-6125HF
Product Overview : Human MEI1 full-length ORF ( AAH32248.1, 1 a.a. - 238 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 238 amino acids
Description : MEI1 (Meiotic Double-Stranded Break Formation Protein 1) is a Protein Coding gene. GO annotations related to this gene include binding.
Molecular Mass : 52 kDa
AA Sequence : MLALTLAKADSPRTALLCSAWLLTASFSAQQHKGSLQVHQTLSVEMDQVLKALSFPKKKAALLSAAILCFLRTALRQSFSSALVALVPSGAQPLPATKDTVLAPLRMSQVRSLVIGLQNLLVQKDPLLSQACVGCLEALLDYLDARSPDIALHVASQPWNRFLLFTLLDAGENSFLRPEILRLMTLLQSMGHLADHSMAQTLQASLEGLPPSTSSGQPPLQDMLCLGGVAVSLSHIRN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MEI1 meiosis inhibitor 1 [ Homo sapiens ]
Official Symbol MEI1
Synonyms MEI1; meiosis inhibitor 1; meiosis inhibitor protein 1; MGC40042; meiosis defective 1; meiosis defective protein 1;
Gene ID 150365
mRNA Refseq NM_152513
Protein Refseq NP_689726
MIM 608797
UniProt ID Q5TIA1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MEI1 Products

Required fields are marked with *

My Review for All MEI1 Products

Required fields are marked with *

0
cart-icon
0
compare icon