Recombinant Full Length Human Membrane Progestin Receptor Beta(Paqr8) Protein, His-Tagged
| Cat.No. : | RFL21894HF |
| Product Overview : | Recombinant Full Length Human Membrane progestin receptor beta(PAQR8) Protein (Q8TEZ7) (1-354aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-354) |
| Form : | Lyophilized powder |
| AA Sequence : | MTTAILERLSTLSVSGQQLRRLPKILEDGLPKMPCTVPETDVPQLFREPYIRTGYRPTGH EWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFAEAEALPWASTHSLPLLLFILSSI TYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYDRFWLFFL PAAAFCGWLSCAGCCYAKYRYRRPYPVMRKICQVVPAGLAFILDISPVAHRVALCHLAGC QEQAAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSICTLSQLEAI LLDYQGRQEIFLQRHGPLSVHMACLSFFFLAACSAATAALLRHKVKARLTKKDS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | PAQR8 |
| Synonyms | PAQR8; C6orf33; LMPB1; MPRB; Membrane progestin receptor beta; mPR beta; Lysosomal membrane protein in brain 1; Membrane progesterone P4 receptor beta; Membrane progesterone receptor beta; Progesterone and adipoQ receptor family member 8; Progestin and ad |
| UniProt ID | Q8TEZ7 |
| ◆ Recombinant Proteins | ||
| PAQR8-1840C | Recombinant Chicken PAQR8 | +Inquiry |
| PAQR8-6494M | Recombinant Mouse PAQR8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PAQR8-9704Z | Recombinant Zebrafish PAQR8 | +Inquiry |
| PAQR8-3302R | Recombinant Rhesus monkey PAQR8 Protein, His-tagged | +Inquiry |
| PAQR8-1324H | Recombinant Human PAQR8 Protein, GST-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PAQR8-3437HCL | Recombinant Human PAQR8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PAQR8 Products
Required fields are marked with *
My Review for All PAQR8 Products
Required fields are marked with *
