Recombinant Human PAQR8 Protein, GST-Tagged
| Cat.No. : | PAQR8-1324H |
| Product Overview : | Human PAQR8 full-length ORF (AAH30664, 1 a.a. - 354 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | PAQR8 (Progestin And AdipoQ Receptor Family Member 8) is a Protein Coding gene. Diseases associated with PAQR8 include Epilepsy With Generalized Tonic-Clonic Seizures and Adolescence-Adult Electroclinical Syndrome. GO annotations related to this gene include steroid hormone receptor activity and steroid binding. An important paralog of this gene is PAQR7. |
| Molecular Mass : | 64.68 kDa |
| AA Sequence : | MTTAILERLSTLSVSGQRLRRLPKILEDGLPKMPCTVPETDVPQLFREPYIRTGYRPTGHEWRYYFFSLFQKHNEVVNVWTHLLAALAVLLRFWAFAEAEALPWASTHSLPLLLFILSSITYLTCSLLAHLLQSKSELSHYTFYFVDYVGVSVYQYGSALAHFFYSSDQAWYDRFWLFFLPAAAFCGWLSCAGCCYAKYCYRRPYPVMRKICQVVPAGLAFILDISPVAHRVALCHLAGCQEQAAWYHTLQILFFLVSAYFFSCPVPEKYFPGSCDIVGHGHQIFHAFLSICTLSQLEAILLDYQGRQEIFLQRHGPLSVHMACLSFFFLAACSAATAALLRHKVKARLTKKDS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | PAQR8 progestin and adipoQ receptor family member VIII [ Homo sapiens ] |
| Official Symbol | PAQR8 |
| Synonyms | PAQR8; progestin and adipoQ receptor family member VIII; C6orf33, chromosome 6 open reading frame 33; membrane progestin receptor beta; LMPB1; MPRB; mPR beta; lysosomal membrane protein in brain 1; lysosomal membrane protein in brain-1; progestin and adipoQ receptor family member 8; C6orf33; FLJ32521; FLJ46206; |
| Gene ID | 85315 |
| mRNA Refseq | NM_133367 |
| Protein Refseq | NP_588608 |
| MIM | 607780 |
| UniProt ID | Q8TEZ7 |
| ◆ Recombinant Proteins | ||
| PAQR8-9704Z | Recombinant Zebrafish PAQR8 | +Inquiry |
| PAQR8-3120R | Recombinant Rhesus Macaque PAQR8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PAQR8-6494M | Recombinant Mouse PAQR8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| PAQR8-3430HF | Recombinant Full Length Human PAQR8 Protein, GST-tagged | +Inquiry |
| PAQR8-3302R | Recombinant Rhesus monkey PAQR8 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PAQR8-3437HCL | Recombinant Human PAQR8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PAQR8 Products
Required fields are marked with *
My Review for All PAQR8 Products
Required fields are marked with *
