Recombinant Full Length Human MEOX1 Protein, GST-tagged
Cat.No. : | MEOX1-6134HF |
Product Overview : | Human MEOX1 full-length ORF ( NP_004518.1, 1 a.a. - 254 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 254 amino acids |
Description : | This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the molecular signaling network regulating somite development. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq |
Molecular Mass : | 54.4 kDa |
AA Sequence : | MDPAASSCMRSLQPPAPVWGCLRNPHSEGNGASGLPHYPPTPFSFHQKPDFLATATAAYPDFSASCLAATPHSLPQEEHIFTEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGSTANETEKKSSRRRKESSDNQENRGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPSSE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MEOX1 mesenchyme homeobox 1 [ Homo sapiens ] |
Official Symbol | MEOX1 |
Synonyms | MEOX1; mesenchyme homeobox 1; mesenchyme homeo box 1; homeobox protein MOX-1; MOX1; |
Gene ID | 4222 |
mRNA Refseq | NM_001040002 |
Protein Refseq | NP_001035091 |
MIM | 600147 |
UniProt ID | P50221 |
◆ Recombinant Proteins | ||
MEOX1-4443H | Recombinant Human MEOX1 Protein, GST-tagged | +Inquiry |
MEOX1-5476M | Recombinant Mouse MEOX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MEOX1-6329C | Recombinant Chicken MEOX1 | +Inquiry |
MEOX1-29355TH | Recombinant Human MEOX1 | +Inquiry |
MEOX1-582Z | Recombinant Zebrafish MEOX1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
MEOX1-4366HCL | Recombinant Human MEOX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MEOX1 Products
Required fields are marked with *
My Review for All MEOX1 Products
Required fields are marked with *