Recombinant Full Length Human MEOX2 Protein
| Cat.No. : | MEOX2-304HF |
| Product Overview : | Recombinant full length Human MEOX 2 with N terminal proprietary tag, 59.07 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 303 amino acids |
| Description : | This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the regulation of vertebrate limb myogenesis. Mutations in the related mouse protein may be associated with craniofacial and/or skeletal abnormalities, in addition to neurovascular dysfunction observed in Alzheimers disease. |
| Form : | Liquid |
| Molecular Mass : | 59.070kDa inclusive of tags |
| AA Sequence : | MEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHMSYPE LSTSSSSCIIAGYPNEEGMFASQHHRGHHHHHHHHHHHHQ QQQHQALQTNWHLPQMSSPPSAARHSLCLQPDSGGPPELG SSPPVLCSNSSSLGSSTPTGAACAPGDYGRQALSPAEAEK RSGGKRKSDSSDSQEGNYKSEVNSKPRKERTAFTKEQIRE LEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMK WKRVKGGQQGAAAREKELVNVKKGTLLPSELSGIGAATLQ QTGDSIANEDSHDSDHSSEHAHL |
| Purity : | Proprietary Purification |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
| Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
| Gene Name | MEOX2 mesenchyme homeobox 2 [ Homo sapiens ] |
| Official Symbol | MEOX2 |
| Synonyms | MEOX2; mesenchyme homeobox 2; GAX, mesenchyme homeo box 2 (growth arrest specific homeo box) , mesenchyme homeobox 2 (growth arrest specific homeo box); homeobox protein MOX-2; growth arrest specific homeobox; MOX2 |
| Gene ID | 4223 |
| mRNA Refseq | NM_005924 |
| Protein Refseq | NP_005915 |
| MIM | 600535 |
| UniProt ID | P50222 |
| ◆ Recombinant Proteins | ||
| MEOX2-240H | Recombinant Human mesenchyme homeobox 2, His-tagged | +Inquiry |
| MEOX2-6135HF | Recombinant Full Length Human MEOX2 Protein, GST-tagged | +Inquiry |
| MEOX2-304HF | Recombinant Full Length Human MEOX2 Protein | +Inquiry |
| MEOX2-9729M | Recombinant Mouse MEOX2 Protein | +Inquiry |
| MEOX2-29604TH | Recombinant Human MEOX2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MEOX2-4365HCL | Recombinant Human MEOX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MEOX2 Products
Required fields are marked with *
My Review for All MEOX2 Products
Required fields are marked with *
