Recombinant Human MEOX2
Cat.No. : | MEOX2-29604TH |
Product Overview : | Recombinant full length Human MEOX 2 with N terminal proprietary tag, 59.07 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 303 amino acids |
Description : | This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the regulation of vertebrate limb myogenesis. Mutations in the related mouse protein may be associated with craniofacial and/or skeletal abnormalities, in addition to neurovascular dysfunction observed in Alzheimers disease. |
Molecular Weight : | 59.070kDa inclusive of tags |
Tissue specificity : | Embryo and placenta. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHMSYPE LSTSSSSCIIAGYPNEEGMFASQHHRGHHHHHHHHHHHHQ QQQHQALQTNWHLPQMSSPPSAARHSLCLQPDSGGPPELG SSPPVLCSNSSSLGSSTPTGAACAPGDYGRQALSPAEAEK RSGGKRKSDSSDSQEGNYKSEVNSKPRKERTAFTKEQIRE LEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMK WKRVKGGQQGAAAREKELVNVKKGTLLPSELSGIGAATLQ QTGDSIANEDSHDSDHSSEHAHL |
Sequence Similarities : | Contains 1 homeobox DNA-binding domain. |
Gene Name | MEOX2 mesenchyme homeobox 2 [ Homo sapiens ] |
Official Symbol | MEOX2 |
Synonyms | MEOX2; mesenchyme homeobox 2; GAX, mesenchyme homeo box 2 (growth arrest specific homeo box) , mesenchyme homeobox 2 (growth arrest specific homeo box); homeobox protein MOX-2; growth arrest specific homeobox; MOX2; |
Gene ID | 4223 |
mRNA Refseq | NM_005924 |
Protein Refseq | NP_005915 |
MIM | 600535 |
Uniprot ID | P50222 |
Chromosome Location | 7p22.1-p21.3 |
Function | protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
◆ Recombinant Proteins | ||
MEOX2-29604TH | Recombinant Human MEOX2 | +Inquiry |
MEOX2-5477M | Recombinant Mouse MEOX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MEOX2-240H | Recombinant Human mesenchyme homeobox 2, His-tagged | +Inquiry |
MEOX2-3647R | Recombinant Rat MEOX2 Protein | +Inquiry |
MEOX2-4440H | Recombinant Human MEOX2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MEOX2-4365HCL | Recombinant Human MEOX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MEOX2 Products
Required fields are marked with *
My Review for All MEOX2 Products
Required fields are marked with *