Recombinant Human MEOX2
| Cat.No. : | MEOX2-29604TH | 
| Product Overview : | Recombinant full length Human MEOX 2 with N terminal proprietary tag, 59.07 kDa. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | Non | 
| Protein Length : | 303 amino acids | 
| Description : | This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the regulation of vertebrate limb myogenesis. Mutations in the related mouse protein may be associated with craniofacial and/or skeletal abnormalities, in addition to neurovascular dysfunction observed in Alzheimers disease. | 
| Molecular Weight : | 59.070kDa inclusive of tags | 
| Tissue specificity : | Embryo and placenta. | 
| Form : | Liquid | 
| Purity : | Proprietary Purification | 
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl | 
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | MEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHMSYPE LSTSSSSCIIAGYPNEEGMFASQHHRGHHHHHHHHHHHHQ QQQHQALQTNWHLPQMSSPPSAARHSLCLQPDSGGPPELG SSPPVLCSNSSSLGSSTPTGAACAPGDYGRQALSPAEAEK RSGGKRKSDSSDSQEGNYKSEVNSKPRKERTAFTKEQIRE LEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMK WKRVKGGQQGAAAREKELVNVKKGTLLPSELSGIGAATLQ QTGDSIANEDSHDSDHSSEHAHL | 
| Sequence Similarities : | Contains 1 homeobox DNA-binding domain. | 
| Gene Name | MEOX2 mesenchyme homeobox 2 [ Homo sapiens ] | 
| Official Symbol | MEOX2 | 
| Synonyms | MEOX2; mesenchyme homeobox 2; GAX, mesenchyme homeo box 2 (growth arrest specific homeo box) , mesenchyme homeobox 2 (growth arrest specific homeo box); homeobox protein MOX-2; growth arrest specific homeobox; MOX2; | 
| Gene ID | 4223 | 
| mRNA Refseq | NM_005924 | 
| Protein Refseq | NP_005915 | 
| MIM | 600535 | 
| Uniprot ID | P50222 | 
| Chromosome Location | 7p22.1-p21.3 | 
| Function | protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; | 
| ◆ Recombinant Proteins | ||
| MEOX2-1244C | Recombinant Chicken MEOX2 | +Inquiry | 
| MEOX2-6135HF | Recombinant Full Length Human MEOX2 Protein, GST-tagged | +Inquiry | 
| MEOX2-3303R | Recombinant Rat MEOX2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| MEOX2-9729M | Recombinant Mouse MEOX2 Protein | +Inquiry | 
| MEOX2-29604TH | Recombinant Human MEOX2 | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| MEOX2-4365HCL | Recombinant Human MEOX2 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MEOX2 Products
Required fields are marked with *
My Review for All MEOX2 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            