Recombinant Full Length Human METTL1 Protein, His tagged

• Cat.No.: METTL1-29205TH
• Product Overview: Recombinant Full Length Human METTL1 Protein with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-276 aa
• Description: This gene is similar in sequence to the S. cerevisiae YDL201w gene. The gene product contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation. Alternative splice variants encoding different protein isoforms have been described for this gene. A pseudogene has been identified on chromosome X.
• AASequence: MGSSHHHHHHSSGLVPRGSHMAAETRNVAGAEAPPPQKRYYRQRAHSNPMADHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH
• Molecular Mass: 34 kDa
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile 50mM Tris, pH7.0, 300mM NaCl, 5mM DTT
• Concentration: 1.42 mg/mL by Bradford

Gene Information

• Gene Name: METTL1 methyltransferase like 1 [ Homo sapiens (human) ]
• Official Symbol: METTL1
• Synonyms: METTL1; methyltransferase like 1; C12orf1, methyltransferase like 1; tRNA (guanine-N(7)-)-methyltransferase; TRM8; D1075-like gene product; methyltransferase-like 1; tRNA(m7G46)-methyltransferase; methyltransferase-like protein 1; tRNA (guanine(46)-N(7))-methyltransferase; C12orf1; YDL201w; FLJ95748
• Gene ID: 4234
• mRNA Refseq: NM_005371
• Protein Refseq: NP_005362
• MIM: 604466
• UniProt ID: Q9UBP6