Recombinant Full Length Human METTL1 Protein, His tagged
Cat.No. : | METTL1-29205TH |
Product Overview : | Recombinant Full Length Human METTL1 Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-276 aa |
Description : | This gene is similar in sequence to the S. cerevisiae YDL201w gene. The gene product contains a conserved S-adenosylmethionine-binding motif and is inactivated by phosphorylation. Alternative splice variants encoding different protein isoforms have been described for this gene. A pseudogene has been identified on chromosome X. |
AASequence : | MGSSHHHHHHSSGLVPRGSHMAAETRNVAGAEAPPPQKRYYRQRAHSNPMADHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQAVTSQTSLPGH |
Molecular Mass : | 34 kDa |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile 50mM Tris, pH7.0, 300mM NaCl, 5mM DTT |
Concentration : | 1.42 mg/mL by Bradford |
Gene Name | METTL1 methyltransferase like 1 [ Homo sapiens (human) ] |
Official Symbol | METTL1 |
Synonyms | METTL1; methyltransferase like 1; C12orf1, methyltransferase like 1; tRNA (guanine-N(7)-)-methyltransferase; TRM8; D1075-like gene product; methyltransferase-like 1; tRNA(m7G46)-methyltransferase; methyltransferase-like protein 1; tRNA (guanine(46)-N(7))-methyltransferase; C12orf1; YDL201w; FLJ95748 |
Gene ID | 4234 |
mRNA Refseq | NM_005371 |
Protein Refseq | NP_005362 |
MIM | 604466 |
UniProt ID | Q9UBP6 |
◆ Recombinant Proteins | ||
METTL1-1482Z | Recombinant Zebrafish METTL1 | +Inquiry |
Mettl1-4040M | Recombinant Mouse Mettl1 Protein, Myc/DDK-tagged | +Inquiry |
METTL1-953H | Recombinant Human METTL1, His-tagged, 33.6kDa (296aa) | +Inquiry |
METTL1-5487M | Recombinant Mouse METTL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
METTL1-866H | Recombinant Human METTL1 protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
METTL1-29205TH | Recombinant Full Length Human METTL1 Protein, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
METTL1-1080HCL | Recombinant Human METTL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All METTL1 Products
Required fields are marked with *
My Review for All METTL1 Products
Required fields are marked with *