Recombinant Full Length Human METTL14 Protein, C-Flag-tagged
Cat.No. : | METTL14-925HFL |
Product Overview : | Recombinant Full Length Human METTL14 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables mRNA binding activity. Contributes to mRNA (2'-O-methyladenosine-N6-)-methyltransferase activity. Involved in mRNA metabolic process; negative regulation of hematopoietic progenitor cell differentiation; and positive regulation of translation. Located in nucleoplasm. Part of RNA N6-methyladenosine methyltransferase complex. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 52 kDa |
AA Sequence : | MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEG ETDEDKMEEYKDELEMQQDEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLA DRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKC WTWDDIMKLEIDEIAAPRSFIFLWCGSGEGLDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAV FQRTKEHCLMGIKGTVKRSTDGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRD STIRPGWLTVGPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGG TSAGRGRERNRSNFRGERGGFRGGRGGAHRGGFPPRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | METTL14 methyltransferase 14, N6-adenosine-methyltransferase subunit [ Homo sapiens (human) ] |
Official Symbol | METTL14 |
Synonyms | hMETTL14 |
Gene ID | 57721 |
mRNA Refseq | NM_020961.4 |
Protein Refseq | NP_066012.1 |
MIM | 616504 |
UniProt ID | Q9HCE5 |
◆ Recombinant Proteins | ||
METTL14-11803Z | Recombinant Zebrafish METTL14 | +Inquiry |
METTL14-925HFL | Recombinant Full Length Human METTL14 Protein, C-Flag-tagged | +Inquiry |
METTL14-35H | Recombinant Human METTL14 Protein (Full Length), N-GST-tagged | +Inquiry |
METTL14-3786H | Recombinant Human METTL14 Protein (Full length), N-GST tagged | +Inquiry |
METTL14-2739R | Recombinant Rhesus monkey METTL14 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
METTL14-4358HCL | Recombinant Human METTL14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All METTL14 Products
Required fields are marked with *
My Review for All METTL14 Products
Required fields are marked with *
0
Inquiry Basket