Recombinant Full Length Human METTL14 Protein, GST-tagged
| Cat.No. : | METTL14-6159HF |
| Product Overview : | Human METTL14 full-length ORF ( NP_066012.1, 1 a.a. - 456 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 456 amino acids |
| Description : | METTL14 (Methyltransferase Like 14) is a Protein Coding gene. Among its related pathways are Gene Expression and mRNA Splicing - Major Pathway. GO annotations related to this gene include RNA binding and mRNA (2-O-methyladenosine-N6-)-methyltransferase activity. |
| Molecular Mass : | 78.6 kDa |
| AA Sequence : | MDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEENLPYEEEIYKDSSTFLKGTQSLNPHNDYCQHFVDTGHRPQNFIRDVGLADRFEEYPKLRELIRLKDELIAKSNTPPMYLQADIEAFDIRELTPKFDVILLEPPLEEYYRETGITANEKCWTWDDIMKLEIDEIAAPRSFIFLWCGSGEGLDLGRVCLRKWGYRRCEDICWIKTNKNNPGKTKTLDPKAVFQRTKEHCLMGIKGTVKRSTDGDFIHANVDIDLIITEEPEIGNIEKPVEIFHIIEHFCLGRRRLHLFGRDSTIRPGWLTVGPTLTNSNYNAETYASYFSAPNSYLTGCTEEIERLRPKSPPPKSKSDRGGGAPRGGGRGGTSAGRGRERNRSNFRGERGGFRGGRGGAHRGGFPPR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | METTL14 methyltransferase like 14 [ Homo sapiens (human) ] |
| Official Symbol | METTL14 |
| Synonyms | METTL14; methyltransferase like 14; Hmettl14; N6-adenosine-methyltransferase subunit METTL14; methyltransferase-like protein 14; EC 2.1.1.62 |
| Gene ID | 57721 |
| mRNA Refseq | NM_020961 |
| Protein Refseq | NP_066012 |
| MIM | 616504 |
| UniProt ID | Q9HCE5 |
| ◆ Recombinant Proteins | ||
| METTL14-3786H | Recombinant Human METTL14 Protein (Full length), N-GST tagged | +Inquiry |
| METTL14-1399H | Recombinant Human METTL14 Protein, His (Fc)-Avi-tagged | +Inquiry |
| METTL14-35H | Recombinant Human METTL14 Protein (Full Length), N-GST-tagged | +Inquiry |
| Mettl14-4041M | Recombinant Mouse Mettl14 Protein, Myc/DDK-tagged | +Inquiry |
| METTL14-33H | Recombinant Human METTL14 protein (Full Length), N-FLAG-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| METTL14-4358HCL | Recombinant Human METTL14 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All METTL14 Products
Required fields are marked with *
My Review for All METTL14 Products
Required fields are marked with *
