Recombinant Full Length Human METTL15 Protein, GST-tagged

Cat.No. : METTL15-6156HF
Product Overview : Human METT5D1 full-length ORF ( AAH30997.1, 1 a.a. - 212 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 212 amino acids
Description : METTL15 (Methyltransferase Like 15) is a Protein Coding gene. GO annotations related to this gene include methyltransferase activity and rRNA (cytosine-N4-)-methyltransferase activity.
Molecular Mass : 49.9 kDa
AA Sequence : MAKLHIPVMVDEVVHCLSPQKGQIFLDMTFGSGGHTKAILQKESDIVLYALDRDPTAYALAEHLSELYPKQIRAMLGQFSQAEALLMKAGVQPGTFDGVLMDLGCSSMQLDTPERGFSLRKDGSLDMRMDGGRSTGTCIYPKNIRGGEACQENRFSNCSGTQHLPHHQNPAACQHRCRSISSLCYLYTERLTTAIYPYCHQDFPGSSHICEQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name METTL15 methyltransferase like 15 [ Homo sapiens (human) ]
Official Symbol METTL15
Synonyms METTL15; methyltransferase like 15; METT5D1; probable methyltransferase-like protein 15; methyltransferase 5 domain containing 1; methyltransferase 5 domain-containing protein 1; probable S-adenosyl-L-methionine-dependent methyltransferase METT5D1; putative S-adenosyl-L-methionine-dependent methyltransferase METT5D1; EC 2.1.1.-
Gene ID 196074
mRNA Refseq NM_001113528
Protein Refseq NP_001107000
MIM 618711
UniProt ID A6NJ78

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All METTL15 Products

Required fields are marked with *

My Review for All METTL15 Products

Required fields are marked with *

0
cart-icon