Recombinant Full Length Human METTL15 Protein, GST-tagged
Cat.No. : | METTL15-6156HF |
Product Overview : | Human METT5D1 full-length ORF ( AAH30997.1, 1 a.a. - 212 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 212 amino acids |
Description : | METTL15 (Methyltransferase Like 15) is a Protein Coding gene. GO annotations related to this gene include methyltransferase activity and rRNA (cytosine-N4-)-methyltransferase activity. |
Molecular Mass : | 49.9 kDa |
AA Sequence : | MAKLHIPVMVDEVVHCLSPQKGQIFLDMTFGSGGHTKAILQKESDIVLYALDRDPTAYALAEHLSELYPKQIRAMLGQFSQAEALLMKAGVQPGTFDGVLMDLGCSSMQLDTPERGFSLRKDGSLDMRMDGGRSTGTCIYPKNIRGGEACQENRFSNCSGTQHLPHHQNPAACQHRCRSISSLCYLYTERLTTAIYPYCHQDFPGSSHICEQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | METTL15 methyltransferase like 15 [ Homo sapiens (human) ] |
Official Symbol | METTL15 |
Synonyms | METTL15; methyltransferase like 15; METT5D1; probable methyltransferase-like protein 15; methyltransferase 5 domain containing 1; methyltransferase 5 domain-containing protein 1; probable S-adenosyl-L-methionine-dependent methyltransferase METT5D1; putative S-adenosyl-L-methionine-dependent methyltransferase METT5D1; EC 2.1.1.- |
Gene ID | 196074 |
mRNA Refseq | NM_001113528 |
Protein Refseq | NP_001107000 |
MIM | 618711 |
UniProt ID | A6NJ78 |
◆ Recombinant Proteins | ||
METTL15-6156HF | Recombinant Full Length Human METTL15 Protein, GST-tagged | +Inquiry |
METTL15-5492M | Recombinant Mouse METTL15 Protein, His (Fc)-Avi-tagged | +Inquiry |
METTL15-2740R | Recombinant Rhesus monkey METTL15 Protein, His-tagged | +Inquiry |
METTL15-943H | Recombinant Human METTL15 Protein, His-tagged | +Inquiry |
METTL15-4295C | Recombinant Chicken METTL15 | +Inquiry |
◆ Cell & Tissue Lysates | ||
METTL15-1079HCL | Recombinant Human METTL15 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All METTL15 Products
Required fields are marked with *
My Review for All METTL15 Products
Required fields are marked with *