Recombinant Full Length Human METTL21A Protein, GST-tagged
Cat.No. : | METTL21A-6168HF |
Product Overview : | Human METTL21A full-length ORF ( NP_660323.2, 1 a.a. - 218 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 218 amino acids |
Description : | METTL21A (Methyltransferase Like 21A) is a Protein Coding gene. Among its related pathways are Metabolism of proteins and Protein methylation. GO annotations related to this gene include methyltransferase activity and Hsp70 protein binding. An important paralog of this gene is EEF1AKMT3. |
Molecular Mass : | 51 kDa |
AA Sequence : | MALVPYEETTEFGLQKFHKPLATFSFANHTIQIRQDWRHLGVAAVVWDAAIVLSTYLEMGAVELRGRSAVELGAGTGLVGIVAALLGAHVTITDRKVALEFLKSNVQANLPPHIQTKTVVKELTWGQNLGSFSPGEFDLILGADIIYLEETFTDLLQTLEHLCSNHSVILLACRIRYERDNNFLAMLERQFIVRKVHYDPEKDVHIYEAQKRNQKEDL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | METTL21A methyltransferase like 21A [ Homo sapiens ] |
Official Symbol | METTL21A |
Synonyms | METTL21A; methyltransferase like 21A; FAM119A, family with sequence similarity 119, member A; methyltransferase-like protein 21A; HCA557b; Hepatocellular carcinoma associated antigen 557b; LOC151194; family with sequence similarity 119, member A; hepatocellular carcinoma-associated antigen 557b; FAM119A; MGC45373; |
Gene ID | 151194 |
mRNA Refseq | NM_001127395 |
Protein Refseq | NP_001120867 |
MIM | 615257 |
UniProt ID | Q8WXB1 |
◆ Recombinant Proteins | ||
METTL21A-9756M | Recombinant Mouse METTL21A Protein | +Inquiry |
METTL21A-5497M | Recombinant Mouse METTL21A Protein, His (Fc)-Avi-tagged | +Inquiry |
METTL21A-4405H | Recombinant Human METTL21A Protein, GST-tagged | +Inquiry |
METTL21A-2219Z | Recombinant Zebrafish METTL21A | +Inquiry |
METTL21A-6168HF | Recombinant Full Length Human METTL21A Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All METTL21A Products
Required fields are marked with *
My Review for All METTL21A Products
Required fields are marked with *
0
Inquiry Basket