Recombinant Full Length Human METTL7A Protein, C-Flag-tagged
| Cat.No. : | METTL7A-849HFL |
| Product Overview : | Recombinant Full Length Human METTL7A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | Predicted to enable methyltransferase activity. Predicted to be involved in methylation. Located in lipid droplet. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 28.1 kDa |
| AA Sequence : | MELTIFILRLAIYILTFPLYLLNFLGLWSWICKKWFPYFLVRFTVIYNEQMASKKRELFSNLQEFAGPSG KLSLLEVGCGTGANFKFYPPGCRVTCIDPNPNFEKFLIKSIAENRHLQFERFVVAAGENMHQVADGSVDV VVCTLVLCSVKNQERILREVCRVLRPGGAFYFMEHVAAECSTWNYFWQQVLDPAWHLLFDGCNLTRESWK ALERASFSKLKLQHIQAPLSWELVRPHIYGYAVKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome, Transmembrane |
| Full Length : | Full L. |
| Gene Name | METTL7A methyltransferase like 7A [ Homo sapiens (human) ] |
| Official Symbol | METTL7A |
| Synonyms | AAMB; AAM-B |
| Gene ID | 25840 |
| mRNA Refseq | NM_014033.4 |
| Protein Refseq | NP_054752.3 |
| MIM | 618338 |
| UniProt ID | Q9H8H3 |
| ◆ Recombinant Proteins | ||
| METTL7A-2570R | Recombinant Rhesus Macaque METTL7A Protein, His (Fc)-Avi-tagged | +Inquiry |
| METTL7A-2749R | Recombinant Rhesus monkey METTL7A Protein, His-tagged | +Inquiry |
| METTL7A-849HFL | Recombinant Full Length Human METTL7A Protein, C-Flag-tagged | +Inquiry |
| METTL7A-6177HF | Recombinant Full Length Human METTL7A Protein, GST-tagged | +Inquiry |
| METTL7A-4982Z | Recombinant Zebrafish METTL7A | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| METTL7A-1085HCL | Recombinant Human METTL7A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All METTL7A Products
Required fields are marked with *
My Review for All METTL7A Products
Required fields are marked with *
