Recombinant Full Length Human METTL7A Protein, C-Flag-tagged

• Cat.No.: METTL7A-849HFL
• Product Overview: Recombinant Full Length Human METTL7A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Predicted to enable methyltransferase activity. Predicted to be involved in methylation. Located in lipid droplet.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 28.1 kDa
• AA Sequence: MELTIFILRLAIYILTFPLYLLNFLGLWSWICKKWFPYFLVRFTVIYNEQMASKKRELFSNLQEFAGPSG KLSLLEVGCGTGANFKFYPPGCRVTCIDPNPNFEKFLIKSIAENRHLQFERFVVAAGENMHQVADGSVDV VVCTLVLCSVKNQERILREVCRVLRPGGAFYFMEHVAAECSTWNYFWQQVLDPAWHLLFDGCNLTRESWK
  ALERASFSKLKLQHIQAPLSWELVRPHIYGYAVKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome, Transmembrane
• Full Length: Full L.

Gene Information

• Gene Name: METTL7A methyltransferase like 7A [ Homo sapiens (human) ]
• Official Symbol: METTL7A
• Synonyms: AAMB; AAM-B
• Gene ID: 25840
• mRNA Refseq: NM_014033.4
• Protein Refseq: NP_054752.3
• MIM: 618338
• UniProt ID: Q9H8H3