Recombinant Full Length Human METTL7B Protein, GST-tagged
Cat.No. : | METTL7B-6179HF |
Product Overview : | Human METTL7B full-length ORF ( NP_689850.1, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 194 amino acids |
Description : | METTL7B (Methyltransferase Like 7B) is a Protein Coding gene. GO annotations related to this gene include methyltransferase activity and S-adenosylmethionine-dependent methyltransferase activity. An important paralog of this gene is METTL7A. |
Molecular Mass : | 48.5 kDa |
AA Sequence : | MESKKRELFSQIKGLTGASGKVALLELGCGTGANFQFYPPGCRVTCLDPNPHFEKFLTKSMAENRHLQYERFVVAPGEDMRQLADGSMDVVVCTLVLCSVQSPRKVLQEVRRVLRPGGVLFFWEHVAEPYGSWAFMWQQVFEPTWKHIGDGCCLTRETWKDLENAQFSEIQMERQPPPLKWLPVGPHIMGKAVK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | METTL7B methyltransferase like 7B [ Homo sapiens ] |
Official Symbol | METTL7B |
Synonyms | METTL7B; methyltransferase like 7B; methyltransferase-like protein 7B; MGC17301; |
Gene ID | 196410 |
mRNA Refseq | NM_152637 |
Protein Refseq | NP_689850 |
UniProt ID | Q6UX53 |
◆ Recombinant Proteins | ||
METTL7B-5943H | Recombinant Human METTL7B protein, His-tagged | +Inquiry |
METTL7B-4398H | Recombinant Human METTL7B Protein, GST-tagged | +Inquiry |
METTL7B-3318R | Recombinant Rat METTL7B Protein, His (Fc)-Avi-tagged | +Inquiry |
METTL7B-3662R | Recombinant Rat METTL7B Protein | +Inquiry |
METTL7B-5504M | Recombinant Mouse METTL7B Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All METTL7B Products
Required fields are marked with *
My Review for All METTL7B Products
Required fields are marked with *
0
Inquiry Basket