Recombinant Full Length Human MFAP3 Protein, GST-tagged
| Cat.No. : | MFAP3-6189HF |
| Product Overview : | Human MFAP3 full-length ORF ( NP_005918.1, 1 a.a. - 362 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 362 amino acids |
| Description : | MFAP3 (Microfibril Associated Protein 3) is a Protein Coding gene. Among its related pathways are Elastic fibre formation and Degradation of the extracellular matrix. An important paralog of this gene is MFAP3L. |
| Molecular Mass : | 66.6 kDa |
| AA Sequence : | MKLHCCLFTLVASIIVPAAFVLEDVDFDQMVSLEANRSSYNASFPSSFELSASSHSDDDVIIAKEGTSVSIECLLTASHYEDVHWHNSKGQQLDGRSRGGKWLVSDNFLNITNVAFDDRGLYTCFVTSPIRASYSVTLRVIFTSGDMSVYYMIVCLIAFTITLILNVTRLCMMSSHLRKTEKAINEFFRTEGAEKLQKAFEIAKRIPIITSAKTLELAKVTQFKTMEFARYIEELARSVPLPPLILNCRAFVEEMFEAVRVDDPDDLGERIKERPALNAQGGIYVINPEMGRSNSPGGDSDDGSLNEQGQEIAVQVSVHLQSETKSIDTESQGSSHFSPPDDIGSAESNCNYKDGAYENCQL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MFAP3 microfibrillar-associated protein 3 [ Homo sapiens ] |
| Official Symbol | MFAP3 |
| Synonyms | MFAP3; microfibrillar-associated protein 3; microfibril-associated glycoprotein 3; DKFZp586F0219; |
| Gene ID | 4238 |
| mRNA Refseq | NM_001135037 |
| Protein Refseq | NP_001128509 |
| MIM | 600491 |
| UniProt ID | P55082 |
| ◆ Recombinant Proteins | ||
| RFL26078HF | Recombinant Full Length Human Microfibril-Associated Glycoprotein 3(Mfap3) Protein, His-Tagged | +Inquiry |
| MFAP3-845H | Recombinant Human MFAP3, GST-tagged | +Inquiry |
| MFAP3-163H | Recombinant Human MFAP3, His-tagged | +Inquiry |
| MFAP3-140H | Recombinant Human MFAP3, His-tagged | +Inquiry |
| MFAP3-5509M | Recombinant Mouse MFAP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MFAP3-4350HCL | Recombinant Human MFAP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MFAP3 Products
Required fields are marked with *
My Review for All MFAP3 Products
Required fields are marked with *
