Recombinant Human MFAP3 Protein, GST-tagged

Cat.No. : MFAP3-4391H
Product Overview : Human MFAP3 full-length ORF ( NP_005918.1, 1 a.a. - 362 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MFAP3 (Microfibril Associated Protein 3) is a Protein Coding gene. Among its related pathways are Elastic fibre formation and Degradation of the extracellular matrix. An important paralog of this gene is MFAP3L.
Molecular Mass : 66.6 kDa
AA Sequence : MKLHCCLFTLVASIIVPAAFVLEDVDFDQMVSLEANRSSYNASFPSSFELSASSHSDDDVIIAKEGTSVSIECLLTASHYEDVHWHNSKGQQLDGRSRGGKWLVSDNFLNITNVAFDDRGLYTCFVTSPIRASYSVTLRVIFTSGDMSVYYMIVCLIAFTITLILNVTRLCMMSSHLRKTEKAINEFFRTEGAEKLQKAFEIAKRIPIITSAKTLELAKVTQFKTMEFARYIEELARSVPLPPLILNCRAFVEEMFEAVRVDDPDDLGERIKERPALNAQGGIYVINPEMGRSNSPGGDSDDGSLNEQGQEIAVQVSVHLQSETKSIDTESQGSSHFSPPDDIGSAESNCNYKDGAYENCQL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MFAP3 microfibrillar-associated protein 3 [ Homo sapiens ]
Official Symbol MFAP3
Synonyms MFAP3; microfibrillar-associated protein 3; microfibril-associated glycoprotein 3; DKFZp586F0219;
Gene ID 4238
mRNA Refseq NM_001135037
Protein Refseq NP_001128509
MIM 600491
UniProt ID P55082

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MFAP3 Products

Required fields are marked with *

My Review for All MFAP3 Products

Required fields are marked with *

0
cart-icon
0
compare icon