Recombinant Human MFAP3 Protein, GST-tagged
Cat.No. : | MFAP3-4391H |
Product Overview : | Human MFAP3 full-length ORF ( NP_005918.1, 1 a.a. - 362 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MFAP3 (Microfibril Associated Protein 3) is a Protein Coding gene. Among its related pathways are Elastic fibre formation and Degradation of the extracellular matrix. An important paralog of this gene is MFAP3L. |
Molecular Mass : | 66.6 kDa |
AA Sequence : | MKLHCCLFTLVASIIVPAAFVLEDVDFDQMVSLEANRSSYNASFPSSFELSASSHSDDDVIIAKEGTSVSIECLLTASHYEDVHWHNSKGQQLDGRSRGGKWLVSDNFLNITNVAFDDRGLYTCFVTSPIRASYSVTLRVIFTSGDMSVYYMIVCLIAFTITLILNVTRLCMMSSHLRKTEKAINEFFRTEGAEKLQKAFEIAKRIPIITSAKTLELAKVTQFKTMEFARYIEELARSVPLPPLILNCRAFVEEMFEAVRVDDPDDLGERIKERPALNAQGGIYVINPEMGRSNSPGGDSDDGSLNEQGQEIAVQVSVHLQSETKSIDTESQGSSHFSPPDDIGSAESNCNYKDGAYENCQL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MFAP3 microfibrillar-associated protein 3 [ Homo sapiens ] |
Official Symbol | MFAP3 |
Synonyms | MFAP3; microfibrillar-associated protein 3; microfibril-associated glycoprotein 3; DKFZp586F0219; |
Gene ID | 4238 |
mRNA Refseq | NM_001135037 |
Protein Refseq | NP_001128509 |
MIM | 600491 |
UniProt ID | P55082 |
◆ Recombinant Proteins | ||
MFAP3-3319R | Recombinant Rat MFAP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
MFAP3-6189HF | Recombinant Full Length Human MFAP3 Protein, GST-tagged | +Inquiry |
MFAP3-9777M | Recombinant Mouse MFAP3 Protein | +Inquiry |
MFAP3-3663R | Recombinant Rat MFAP3 Protein | +Inquiry |
MFAP3-163H | Recombinant Human MFAP3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MFAP3-4350HCL | Recombinant Human MFAP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MFAP3 Products
Required fields are marked with *
My Review for All MFAP3 Products
Required fields are marked with *
0
Inquiry Basket