Recombinant Full Length Human MFSD4A Protein, GST-tagged

• Cat.No.: MFSD4A-6200HF
• Product Overview: Human MFSD4 full-length ORF (1 a.a. - 115 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 115 amino acids
• Description: MFSD4A (Major Facilitator Superfamily Domain Containing 4A) is a Protein Coding gene. An important paralog of this gene is MFSD4B.
• Molecular Mass: 39.1 kDa
• AA Sequence: MGCDGRVSGLLRRNLQPTLTYWSVFFSFGLCIAFLGPTVLVTGAGVGEMVLQMLVGSIFQAQGSYSFLVCGVIFGCLAFTFYILLLFFHRMHPGLPSVPTQDRSIGMENSECYQR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MFSD4A major facilitator superfamily domain containing 4A [ Homo sapiens (human) ]
• Official Symbol: MFSD4A
• Synonyms: MFSD4A; major facilitator superfamily domain containing 4A; MFSD4; UNQ3064; major facilitator superfamily domain-containing protein 4A; major facilitator superfamily domain containing 4; major facilitator superfamily domain-containing protein 4
• Gene ID: 148808
• mRNA Refseq: NM_181644
• Protein Refseq: NP_857595
• UniProt ID: Q8N468