Recombinant Human MFSD4A Protein, GST-tagged

Cat.No. : MFSD4A-4375H
Product Overview : Human MFSD4 full-length ORF (1 a.a. - 115 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : MFSD4A (Major Facilitator Superfamily Domain Containing 4A) is a Protein Coding gene. An important paralog of this gene is MFSD4B.
Molecular Mass : 39.1 kDa
AA Sequence : MGCDGRVSGLLRRNLQPTLTYWSVFFSFGLCIAFLGPTVLVTGAGVGEMVLQMLVGSIFQAQGSYSFLVCGVIFGCLAFTFYILLLFFHRMHPGLPSVPTQDRSIGMENSECYQR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MFSD4A major facilitator superfamily domain containing 4A [ Homo sapiens (human) ]
Official Symbol MFSD4A
Synonyms MFSD4A; major facilitator superfamily domain containing 4A; MFSD4; UNQ3064; major facilitator superfamily domain-containing protein 4A; major facilitator superfamily domain containing 4; major facilitator superfamily domain-containing protein 4
Gene ID 148808
mRNA Refseq NM_181644
Protein Refseq NP_857595
UniProt ID Q8N468

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MFSD4A Products

Required fields are marked with *

My Review for All MFSD4A Products

Required fields are marked with *

0
cart-icon
0
compare icon