Recombinant Human MFSD4A Protein, GST-tagged
| Cat.No. : | MFSD4A-4375H |
| Product Overview : | Human MFSD4 full-length ORF (1 a.a. - 115 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | MFSD4A (Major Facilitator Superfamily Domain Containing 4A) is a Protein Coding gene. An important paralog of this gene is MFSD4B. |
| Molecular Mass : | 39.1 kDa |
| AA Sequence : | MGCDGRVSGLLRRNLQPTLTYWSVFFSFGLCIAFLGPTVLVTGAGVGEMVLQMLVGSIFQAQGSYSFLVCGVIFGCLAFTFYILLLFFHRMHPGLPSVPTQDRSIGMENSECYQR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MFSD4A major facilitator superfamily domain containing 4A [ Homo sapiens (human) ] |
| Official Symbol | MFSD4A |
| Synonyms | MFSD4A; major facilitator superfamily domain containing 4A; MFSD4; UNQ3064; major facilitator superfamily domain-containing protein 4A; major facilitator superfamily domain containing 4; major facilitator superfamily domain-containing protein 4 |
| Gene ID | 148808 |
| mRNA Refseq | NM_181644 |
| Protein Refseq | NP_857595 |
| UniProt ID | Q8N468 |
| ◆ Recombinant Proteins | ||
| MFSD4A-4375H | Recombinant Human MFSD4A Protein, GST-tagged | +Inquiry |
| MFSD4A-10817Z | Recombinant Zebrafish MFSD4A | +Inquiry |
| MFSD4A-6200HF | Recombinant Full Length Human MFSD4A Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MFSD4A Products
Required fields are marked with *
My Review for All MFSD4A Products
Required fields are marked with *



