Recombinant Full Length Human MGC70870 Protein, GST-tagged

• Cat.No.: MGC70870-6443HF
• Product Overview: Human MGC70870 full-length ORF ( NP_982348.1, 1 a.a. - 149 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 149 amino acids
• Description: MGC70870 (C-Terminal Binding Protein 2 Pseudogene) is a Pseudogene.
• Molecular Mass: 42.7 kDa
• AA Sequence: MQEIHEKVLNEVVGAMMYHNFSLTREDLENFKALRVIMQVGSGYDNVAIKAAGELEIALCSIPSAAVEETADSTTGHILNLYWGNRSLYQALREGTRVHSVEQIGEVASVKARIRGEILGLIGFGRTQQEVAVRAKAFAGWDRAVPGCA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MGC70870 C-terminal binding protein 2 pseudogene [ Homo sapiens (human) ]
• Official Symbol: MGC70870
• Synonyms: MGC70870; C-terminal binding protein 2 pseudogene
• Gene ID: 403340