Recombinant Full Length Human MGC70870 Protein, GST-tagged

Cat.No. : MGC70870-6443HF
Product Overview : Human MGC70870 full-length ORF ( NP_982348.1, 1 a.a. - 149 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 149 amino acids
Description : MGC70870 (C-Terminal Binding Protein 2 Pseudogene) is a Pseudogene.
Molecular Mass : 42.7 kDa
AA Sequence : MQEIHEKVLNEVVGAMMYHNFSLTREDLENFKALRVIMQVGSGYDNVAIKAAGELEIALCSIPSAAVEETADSTTGHILNLYWGNRSLYQALREGTRVHSVEQIGEVASVKARIRGEILGLIGFGRTQQEVAVRAKAFAGWDRAVPGCA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MGC70870 C-terminal binding protein 2 pseudogene [ Homo sapiens (human) ]
Official Symbol MGC70870
Synonyms MGC70870; C-terminal binding protein 2 pseudogene;
Gene ID 403340

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MGC70870 Products

Required fields are marked with *

My Review for All MGC70870 Products

Required fields are marked with *

0
cart-icon
0
compare icon