Recombinant Full Length Human MIER1 Protein, GST-tagged
| Cat.No. : | MIER1-6592HF |
| Product Overview : | Human MIER1 full-length ORF ( AAH17423.1, 1 a.a. - 156 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 156 amino acids |
| Description : | This gene encodes a protein that was first identified in Xenopus laevis by its role in a mesoderm induction early response (MIER). The encoded protein functions as a transcriptional regulator. Alternatively spliced transcript variants encode multiple isoforms, some of which lack a C-terminal nuclear localization signal. [provided by RefSeq, May 2013] |
| Molecular Mass : | 44.2 kDa |
| AA Sequence : | MMEGETNFSSEIEDLAREGDMPIHELLSLYGYGSTVRLPEEDEEEEEEEEEGEDDEDADNDDNSGCSGENKEENIKDSSGQEDETQSSNDDPSQSVASQDAQEIIRPRRCKYFDTNSEVEEESEEDEDYIPSEDWKKEIMVGSMFQAEIPVGICRY |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MIER1 mesoderm induction early response 1 homolog (Xenopus laevis) [ Homo sapiens ] |
| Official Symbol | MIER1 |
| Synonyms | MIER1; mesoderm induction early response 1 homolog (Xenopus laevis); mesoderm induction early response protein 1; hMI ER1; KIAA1610; MI ER1; ER1; MI-ER1; hMI-ER1; RP5-944N15.1; MGC131940; MGC150640; MGC150641; DKFZp781G0451; |
| Gene ID | 57708 |
| mRNA Refseq | NM_001077700 |
| Protein Refseq | NP_001071168 |
| MIM | 616848 |
| UniProt ID | Q8N108 |
| ◆ Recombinant Proteins | ||
| MIER1-2948C | Recombinant Chicken MIER1 | +Inquiry |
| MIER1-5334H | Recombinant Human MIER1 Protein, GST-tagged | +Inquiry |
| MIER1-6592HF | Recombinant Full Length Human MIER1 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MIER1-1113HCL | Recombinant Human MIER1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MIER1 Products
Required fields are marked with *
My Review for All MIER1 Products
Required fields are marked with *
