Recombinant Full Length Human MIF4GD Protein, GST-tagged

• Cat.No.: MIF4GD-6598HF
• Product Overview: Human MIF4GD full-length ORF ( NP_065730.2, 1 a.a. - 256 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 256 amino acids
• Description: This gene encodes a protein which contains an MIF4G domain. [provided by RefSeq
• Molecular Mass: 55.8 kDa
• AA Sequence: MGEPSREEYKIQSFDAETQQLLKTALKVACFETEDGEYSVCQRSYSNCSRLMPSRCNTQYRDPGAVDLEKVANVIVDHSLQDCVFSKEAGRMCYAIIQAESKQAGQSVFRRGLLNRLQQEYQAREQLRARSLQGWVCYVTFICNIFDYLRVNNMPMMALVNPVYDCLFRLAQPDSLSKEEEVDCLVLQLHRVGEQLEKMNGQRMDELFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MIF4GD MIF4G domain containing [ Homo sapiens (human) ]
• Official Symbol: MIF4GD
• Synonyms: MIF4GD; MIF4G domain containing; MIFD; AD023; SLIP1; MIF4G domain-containing protein; SLBP (stem loop binding protein)-interacting protein 1; SLBP-interacting protein 1
• Gene ID: 57409
• mRNA Refseq: NM_001242498
• Protein Refseq: NP_001229427
• MIM: 612072
• UniProt ID: A9UHW6