Recombinant Full Length Human MIF4GD Protein, GST-tagged
| Cat.No. : | MIF4GD-6598HF |
| Product Overview : | Human MIF4GD full-length ORF ( NP_065730.2, 1 a.a. - 256 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 256 amino acids |
| Description : | This gene encodes a protein which contains an MIF4G domain. [provided by RefSeq |
| Molecular Mass : | 55.8 kDa |
| AA Sequence : | MGEPSREEYKIQSFDAETQQLLKTALKVACFETEDGEYSVCQRSYSNCSRLMPSRCNTQYRDPGAVDLEKVANVIVDHSLQDCVFSKEAGRMCYAIIQAESKQAGQSVFRRGLLNRLQQEYQAREQLRARSLQGWVCYVTFICNIFDYLRVNNMPMMALVNPVYDCLFRLAQPDSLSKEEEVDCLVLQLHRVGEQLEKMNGQRMDELFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | MIF4GD MIF4G domain containing [ Homo sapiens (human) ] |
| Official Symbol | MIF4GD |
| Synonyms | MIF4GD; MIF4G domain containing; MIFD; AD023; SLIP1; MIF4G domain-containing protein; SLBP (stem loop binding protein)-interacting protein 1; SLBP-interacting protein 1 |
| Gene ID | 57409 |
| mRNA Refseq | NM_001242498 |
| Protein Refseq | NP_001229427 |
| MIM | 612072 |
| UniProt ID | A9UHW6 |
| ◆ Recombinant Proteins | ||
| MIF4GD-5338H | Recombinant Human MIF4GD Protein, GST-tagged | +Inquiry |
| MIF4GD-3340R | Recombinant Rat MIF4GD Protein, His (Fc)-Avi-tagged | +Inquiry |
| MIF4GD-608H | Recombinant Human MIF4GD Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MIF4GD-3684R | Recombinant Rat MIF4GD Protein | +Inquiry |
| MIF4GD-3477H | Recombinant Human MIF4GD Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MIF4GD-4315HCL | Recombinant Human MIF4GD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MIF4GD Products
Required fields are marked with *
My Review for All MIF4GD Products
Required fields are marked with *


