Recombinant Human MIF4GD Protein, GST-tagged

Cat.No. : MIF4GD-5338H
Product Overview : Human MIF4GD full-length ORF ( NP_065730.2, 1 a.a. - 256 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein which contains an MIF4G domain. [provided by RefSeq
Molecular Mass : 55.8 kDa
AA Sequence : MGEPSREEYKIQSFDAETQQLLKTALKVACFETEDGEYSVCQRSYSNCSRLMPSRCNTQYRDPGAVDLEKVANVIVDHSLQDCVFSKEAGRMCYAIIQAESKQAGQSVFRRGLLNRLQQEYQAREQLRARSLQGWVCYVTFICNIFDYLRVNNMPMMALVNPVYDCLFRLAQPDSLSKEEEVDCLVLQLHRVGEQLEKMNGQRMDELFVLIRDGFLLPTGLSSLAQLLLLEIIEFRAAGWKTTPAAHKYYYSEVSD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MIF4GD MIF4G domain containing [ Homo sapiens (human) ]
Official Symbol MIF4GD
Synonyms MIF4GD; MIF4G domain containing; MIFD; AD023; SLIP1; MIF4G domain-containing protein; SLBP (stem loop binding protein)-interacting protein 1; SLBP-interacting protein 1
Gene ID 57409
mRNA Refseq NM_001242498
Protein Refseq NP_001229427
MIM 612072
UniProt ID A9UHW6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MIF4GD Products

Required fields are marked with *

My Review for All MIF4GD Products

Required fields are marked with *

0
cart-icon