Recombinant Full Length Human MITD1 Protein, C-Flag-tagged
Cat.No. : | MITD1-2159HFL |
Product Overview : | Recombinant Full Length Human MITD1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Abscission, the separation of daughter cells at the end of cytokinesis, is effected by endosomal sorting complexes required for transport III (ESCRT-III). The protein encoded by this gene functions as a homodimer, with the N-termini binding to a subset of ESCRT-III subunits and the C-termini binding to membranes. The encoded protein regulates ESCRT-III activity and is required for proper cytokinesis. Several transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 29.1 kDa |
AA Sequence : | MAKSGLRQDPQSTAAATVLKRAVELDSESRYPQALVCYQEGIDLLLQVLKGTKDNTKRCNLREKISKYMD RAENIKKYLDQEKEDGKYHKQIKIEENATGFSYESLFREYLNETVTEVWIEDPYIRHTHQLYNFLRFCEM LIKRPCKVKTIHLLTSLDEGIEQVQQSRGLQEIEESLRSHGVLLEVQYSSSIHDREIRFNNGWMIKIGRG LDYFKKPQSRFSLGYCDFDLRPCHETTVDIFHKKHTKNI myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | MITD1 microtubule interacting and trafficking domain containing 1 [ Homo sapiens (human) ] |
Official Symbol | MITD1 |
Synonyms | domain containing 1; microtubule interacting and transport; MIT |
Gene ID | 129531 |
mRNA Refseq | NM_138798.3 |
Protein Refseq | NP_620153.1 |
UniProt ID | Q8WV92 |
◆ Recombinant Proteins | ||
MITD1-3349R | Recombinant Rat MITD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MITD1-1265H | Recombinant Human MITD1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MITD1-10545Z | Recombinant Zebrafish MITD1 | +Inquiry |
MITD1-2159HFL | Recombinant Full Length Human MITD1 Protein, C-Flag-tagged | +Inquiry |
MITD1-890H | Recombinant Human MITD1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MITD1-4307HCL | Recombinant Human MITD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MITD1 Products
Required fields are marked with *
My Review for All MITD1 Products
Required fields are marked with *
0
Inquiry Basket