Recombinant Full Length Human Mitochondrial Inner Membrane Organizing System Protein 1(Minos1) Protein, His-Tagged
Cat.No. : | RFL30378HF |
Product Overview : | Recombinant Full Length Human Mitochondrial inner membrane organizing system protein 1(MINOS1) Protein (Q5TGZ0) (1-78aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-78) |
Form : | Lyophilized powder |
AA Sequence : | MSESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQH DFQAPYLLHGKYVKEQEQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MINOS1 |
Synonyms | MICOS10; C1orf151; MIC10; MINOS1; MICOS complex subunit MIC10; Mitochondrial inner membrane organizing system protein 1 |
UniProt ID | Q5TGZ0 |
◆ Recombinant Proteins | ||
MINOS1-4890H | Recombinant Human MINOS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MINOS1-5562M | Recombinant Mouse MINOS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MINOS1-3688R | Recombinant Rat MINOS1 Protein | +Inquiry |
RFL1502MF | Recombinant Full Length Mouse Mitochondrial Inner Membrane Organizing System Protein 1(Minos1) Protein, His-Tagged | +Inquiry |
MINOS1-9846M | Recombinant Mouse MINOS1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MINOS1-8178HCL | Recombinant Human C1orf151 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MINOS1 Products
Required fields are marked with *
My Review for All MINOS1 Products
Required fields are marked with *